KEGG   Aggregatibacter aphrophilus: NT05HA_1232Help
Entry
NT05HA_1232       CDS       T00929                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NT05HA_1232
   00240 Pyrimidine metabolism
    NT05HA_1232
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NT05HA_1232
   03430 Mismatch repair
    NT05HA_1232
   03440 Homologous recombination
    NT05HA_1232
Enzymes [BR:aap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NT05HA_1232
DNA replication proteins [BR:aap03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NT05HA_1232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1244381..1244827)
Genome map
AA seq 148 aa AA seqDB search
MPKNAQFYLLTDTSPARPNLSAMESLACDLATSAWRLGKRVLLVCESEAQALKIDEALWQ
REPDEFVPHNLSGEPTTYATPIEISWTGKRNAQSRDLLINLQPQLPEYINSFNQIIDFVP
VEEQPKALARERYKQLRQLGWALSTEQV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaaaacgcacaattttacttacttaccgacacctcgcccgcccgaccaaattta
tccgctatggaaagtttggcttgcgatcttgccacctctgcatggcgacttggcaagcga
gtgctgttggtgtgcgaaagcgaggcgcaggcgttgaaaattgacgaggctttgtggcaa
cgggaacccgacgagttcgtcccacacaatctttccggcgaacccactacgtatgccacg
cccattgaaattagttggacgggcaaacgcaatgcgcaaagccgtgatttactgattaat
ctgcaaccgcaactgccagaatatattaatagttttaatcaaattatcgactttgttcct
gtggaagaacaaccaaaagccttagcgcgtgaacgttataaacaactaagacagttaggc
tgggcgttgagtacggagcaggtataa

DBGET integrated database retrieval system