KEGG   Aggregatibacter aphrophilus: NT05HA_1444Help
Entry
NT05HA_1444       CDS       T00929                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NT05HA_1444
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NT05HA_1444
Enzymes [BR:aap01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     NT05HA_1444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1447763..1449040
Genome map
AA seq 425 aa AA seqDB search
MQKFRVYGQSCLKGTVEVSGAKNAALPILFAAILATEPVTLTNVPDLKDIETTLKILRQL
GVFVERNEQGIVHLDASKIDHFVAPYELVKTMRASIWALAPLVARFNQGQVSLPGGCSIG
ARPVDLHISGLERLGAQIALEDGYVKAHVNGCLTGTRIVMEKVSVGATLSIMIAATLAKG
TTVIENAAREPEIADTAEFLNKMGAKISGAGSDAITIEGVERLTGCQHSIVPDRIETGTF
LVAAAISGGRILCKNTKAGTLDAVIDKLREAGAQVDVTEDTVTLDMLGNRPKAVNIRTAP
YPGFPTDMQAQFTLLNMIANGTSIITETIFENRFMHIPELIRMGGKAEIEGNTAICHGVE
HLSGAEVMATDLRASISLVLAGCIATGETIVDRIYHIDRGYERIEEKLRGLGAHIERFSE
ENEEI
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttcgtgtttacggacagtcttgtttaaaaggcacagtagaggtttccggc
gctaaaaatgccgcgttaccaattcttttcgccgcaattttagccacagaacccgtaaca
ttaaccaatgtgcccgatctcaaagatattgaaaccacactaaaaatcttacgccaatta
ggcgttttcgttgagcgtaatgaacaaggtatcgtgcatttagatgcatctaaaatcgat
cattttgttgcaccttacgaactggttaaaaccatgcgagcctccatttgggcgctcgca
ccattagttgcccgttttaaccaaggacaggtctcactaccgggaggttgttctattggc
gcacgtcctgtggatttacatattagcggcttagaacgcctcggcgctcaaattgcgctt
gaagacggttatgtaaaagctcatgtaaatggttgtttaaccggtactcgcattgtgatg
gagaaagtcagcgtaggagctacactctccattatgattgctgcaaccctagccaaaggc
acaacggtaattgaaaatgccgcacgcgaaccggaaattgccgatactgcagaattctta
aataaaatgggtgcgaaaatcagcggtgcaggttctgatgcaattactatcgagggtgta
gaacgcttaaccggttgccaacatagtattgttcccgatcgcattgaaaccgggacattc
ttggttgctgcagcgatttccggtggtcgcattctatgcaaaaatactaaagctggcacc
ctagacgccgttattgataaactacgtgaagccggtgctcaagtagacgtgaccgaagat
actgtcacgctagatatgcttggtaatcgtccgaaagcagtaaatattcgcaccgcacct
tacccgggttttccaacagatatgcaagcacaattcaccttgctaaacatgatagcaaac
ggtaccagtatcatcaccgaaactatctttgaaaaccgtttcatgcacattcctgaactg
attcgtatgggcggtaaagcagaaatcgaaggtaacacagcaatctgccacggcgttgaa
cacttgtccggtgcagaagtgatggcaactgatttacgcgcctctatcagcttagttctc
gccggttgtattgccacaggtgaaaccatcgtcgatcgtatttaccatattgaccgtggc
tatgaacgcattgaggaaaaactacgcggcctcggagcccacattgaacgtttttcggaa
gaaaacgaagagatttaa

DBGET integrated database retrieval system