KEGG   Aggregatibacter aphrophilus: NT05HA_1521Help
Entry
NT05HA_1521       CDS       T00929                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aap01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aap00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1524685..1525791)
Genome map
AA seq 368 aa AA seqDB search
MQHHNKTIVVKFGTSTLTQGSPKLNLAYMMEIVRQLAQLHQAGFRLVIVTSGAIAAGRHY
LNHPQLPPTVASKQLLAAVGQSQLIQTWEKLFAIYDIHIGQMLLTRADIEDRERFLNARD
TLQALLDNQIIPVINENDAVATAEIKVGDNDNLSALVAILVQAEQLYLLTDQQGLFDSDP
RKNPQAKLIPVVDKITDHIRSIAGGSGTNLGTGGMSTKITAADVATRSGIETIIAPGNQA
NVIVDLAYEQAIGTKFTVQADRLESRKQWLFAAPSAGGLVVDDGAESAVLIQHKSLLPAG
IVEVSGRFSRGEVVRIRTRSGKDIALGMPRYNSDALELIKGKHSQDIEHILGYEYGAVAV
HRDDMIVL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatcataataaaactattgtagtgaaatttggcaccagcacgttaacccaaggt
tccccaaaattgaatttggcttatatgatggaaattgtgcgtcaacttgcgcaattacat
caagccggttttcgcttggtgatcgtcacctccggcgctattgcggcggggcgtcattat
ttgaatcatccgcaattgccaccgacagtggcctctaagcaattattggcggcagtgggg
cagagccagttgatccagacctgggaaaaattatttgcgatttatgacattcacatcgga
cagatgttgctaacccgcgccgatattgaagatcgcgaacgttttttgaatgcccgcgat
acattacaggcgctgttagacaatcagattattccggtcatcaatgaaaatgacgcggtg
gcaacggcggaaattaaagtcggggataacgataatttatcggcgttggtggcgatttta
gtgcaagcagaacagctttatttgctcacggatcaacaagggttatttgacagcgaccca
cgtaaaaacccgcaagcgaaattaattcccgtggtggataaaatcaccgatcatattcgt
tctattgccggtggtagcgggacgaatttaggcacaggtggaatgtctaccaaaattacg
gccgcggatgtcgcgacccgctccggcattgaaaccattattgcaccgggcaaccaagcc
aatgtgattgtggatttagcgtatgagcaggcgattggtacgaaattcaccgtgcaggcg
gatcgtttggaaagtcgtaaacagtggttatttgcggcaccatcggccggggggttggtg
gtggatgacggcgccgaaagtgcggtgttaattcagcataaatccttattgccggcaggt
atcgtcgaagtcagcggacgtttttcccgtggtgaagtggtgcgtattcgcacgcgatca
ggcaaggatattgcgctgggtatgccacgttataatagcgatgcgttagagcttatcaaa
ggtaaacattcgcaagatatcgaacacattttaggctatgagtatggtgcggtggcggtg
catcgtgatgatatgattgtgttgtaa

DBGET integrated database retrieval system