KEGG   Aggregatibacter aphrophilus: NT05HA_1524Help
Entry
NT05HA_1524       CDS       T00929                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aap  Aggregatibacter aphrophilus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NT05HA_1524
   00670 One carbon pool by folate
    NT05HA_1524
Enzymes [BR:aap01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     NT05HA_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1527246..1527731
Genome map
AA seq 161 aa AA seqDB search
MSLSLIVAMTKNRVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN
IVLSRQPFEHDGVIWKDSLESAVDFVRDSKEIMLIGGGQLFNEYLSKADRLYLTEIQTEL
DGDTFFPSINWDEWFIEFEQYRPADEQNPYDCRFLILLKKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgagcttaagcctgattgtcgctatgaccaaaaaccgtgttatcggtaaagataaccaa
atgccatggcacttgcctgcggatcttgcttggtttcgccaaaacaccaccggcaaaccc
gtcatcatggggcgcaaaacctttgaaagcatcggtcgtcccctcccgaaacgcaccaac
atcgttctgtcccgccaaccttttgagcatgacggcgtgatttggaaagatagcctggaa
agtgcggtggattttgtccgtgattctaaagagatcatgcttatcggtggcggtcaatta
ttcaacgaatatttatcgaaagccgatcgcctctaccttacggaaatccaaacggagctg
gatggcgacactttcttcccatcaattaattgggacgaatggttcattgaatttgaacaa
tatcgccctgctgacgagcaaaatccttacgattgtcgatttttgattttgctgaaaaag
aaataa

DBGET integrated database retrieval system