KEGG   Aggregatibacter aphrophilus: NT05HA_1725Help
Entry
NT05HA_1725       CDS       T00929                                 

Definition
fructose-bisphosphate aldolase
Orthology
K01624  
fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:aap01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:aap01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aap00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:aap00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aap00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:aap00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1715347..1716426
Genome map
AA seq 359 aa AA seqDB search
MAKLLDLVKPGVLTGEDVQKVFAYAKEHGFAIPAVNCVGSDSVNAVLETAARVKAPVIIQ
FSNGGAAFYAGKGIKPTSGARPDVLGAIAGAKHVHTLAKEYGVPVILHTDHAAKKLLPWI
DGLLEAGEKHFAETGRPLFSSHMLDLSEEPMEENMAICREYLARMDKMGMTLEIEIGITG
GEEDGVDNSDVDESRLYTQPSDVLYVYDQLHLVSPNFTVAAAFGNVHGVYKPGNVKLKPS
ILGASQEFVAKERNLPAKPINFVFHGGSGSSREEIREAISYGAIKMNIDTDTQWAAWNGI
LNFYKANEAYLQGQLGNPEGPDAPNKKYYDPRIWLRKMEESMSKRLEQSFEDLNCVDVL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggctaaattattagatctcgtcaaaccaggcgtgcttactggtgaagatgtacaaaaa
gtatttgcatacgcaaaagaacacggctttgccattcctgccgtaaactgtgtcggttcc
gactccgtcaatgccgtactagaaactgcagcacgcgtaaaagcacctgtaattattcaa
ttttctaacggcggtgcggcattctatgcaggtaaaggcattaaaccaactagcggtgcc
cgtcctgacgtgttaggtgccattgcaggagcaaaacacgttcatactttagccaaagaa
tacggcgtgccggtcattttacacactgaccacgcggcgaaaaaattacttccatggatc
gacggcttacttgaagccggtgaaaaacacttcgcggaaaccggtcgtcccttattctct
tcccacatgcttgacctttccgaagagccaatggaagaaaacatggcaatctgtcgcgaa
tatcttgcccgtatggacaaaatgggtatgactcttgaaatcgaaatcggtatcaccggt
ggtgaagaagatggtgtggataactccgatgtggatgaatcccgtctttacacccaaccg
tctgatgtgctttatgtttacgaccaattacatctagttagcccgaactttaccgttgcc
gcagcattcggtaacgtacacggtgtttacaaaccgggtaacgtgaaattaaaaccatct
attttaggcgcaagccaagaattcgtggccaaagagcgtaatctaccggcgaaaccaatt
aatttcgtcttccacggcggttccggttcttcccgtgaagaaattcgtgaagccatcagt
tacggtgcgatcaaaatgaacatcgataccgacacacaatgggccgcttggaacggtatt
ttaaacttctacaaagcgaacgaagcatatttgcaaggtcaattaggcaaccctgaaggc
cctgatgcaccaaacaaaaaatactacgatccacgtatttggttacgtaaaatggaagaa
tcaatgtctaaacgcttagaacaatctttcgaagacttaaactgtgttgatgttttataa

DBGET integrated database retrieval system