KEGG   Aggregatibacter aphrophilus: NT05HA_1727Help
Entry
NT05HA_1727       CDS       T00929                                 

Definition
CrcB protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NT05HA_1727
Enzymes [BR:aap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     NT05HA_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1717745..1718698
Genome map
AA seq 317 aa AA seqDB search
MQPFNSAQLHQFAAQYPLQYLNGKNGCRLAYRHFIHHPTARELVIMVNGRAENILKWTEL
AYDFYQQGYDVLVFDHRGQGYSQRLLKDGEKGHLDEFRFYAEDMAEIIDNLTALYPYPNQ
YILAHSLGALVTTYYLANFDHRIQRAVFSAPFFGVPLKQPVRDEILLNMMMLWGQGERYV
FGKGPYKPANLQENNLSHDATRMQWMNEVNLANPDIRLGGPTFRWVHLCLNAIKHLPKII
RRVETPVLVLEAEEEKIVNNKTLEKLTALFAHGRLRKIARAKHEILFETDDIRTPTLQHI
YAFFTSTRNEQVINRIV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgtttaatagtgctcaattacaccaattcgccgctcaatacccgttgcaatat
ctcaacgggaaaaacggctgtcgactggcatatcgtcattttattcatcatccgacggcg
cgtgagttggtgatcatggtgaatggtcgggcggaaaatattttgaaatggacggaactg
gcttacgatttttatcaacaaggctatgatgtactggtttttgaccatcgcggacaaggt
tattcccaacgtttattgaaagacggcgaaaaaggtcatttagatgagtttcgtttttat
gctgaagatatggcagaaattatcgacaatctgaccgcactttatccttatcccaaccaa
tatattttggcccattccctcggcgctttagtcacaacctattatttggcaaatttcgac
cacagaattcaacgtgcggtgttttctgcaccattttttggcgtgccgttaaaacagccc
gtacgtgatgaaattctgttaaacatgatgatgttgtgggggcaaggagaacgctatgtg
ttcggcaaaggaccatataaacccgctaacctacaggaaaataacctcagccatgatgcc
acgcgaatgcagtggatgaatgaagtgaatttagccaatccggatattcgtttgggcgga
ccgacgttccgctgggtacatttatgtttaaatgcgataaaacatctgccgaaaatcatt
cgtcgggtagaaacgccggtattagtgttggaagcggaagaggaaaagatcgtgaacaat
aaaacgttggaaaaactgaccgcactttttgctcatgggcgcctgcgcaaaatcgcccgc
gccaaacatgaaatcctgtttgaaaccgacgatattcgcacgccgacgttgcagcatatt
tatgcgttttttacttcaacacgtaacgaacaagtaataaaccgaatagtgtaa

DBGET integrated database retrieval system