KEGG   Aggregatibacter aphrophilus: NT05HA_1727Help
Entry
NT05HA_1727       CDS       T00929                                 

Definition
CrcB protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:aap00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1717745..1718698
Genome map
AA seq 317 aa AA seqDB search
MQPFNSAQLHQFAAQYPLQYLNGKNGCRLAYRHFIHHPTARELVIMVNGRAENILKWTEL
AYDFYQQGYDVLVFDHRGQGYSQRLLKDGEKGHLDEFRFYAEDMAEIIDNLTALYPYPNQ
YILAHSLGALVTTYYLANFDHRIQRAVFSAPFFGVPLKQPVRDEILLNMMMLWGQGERYV
FGKGPYKPANLQENNLSHDATRMQWMNEVNLANPDIRLGGPTFRWVHLCLNAIKHLPKII
RRVETPVLVLEAEEEKIVNNKTLEKLTALFAHGRLRKIARAKHEILFETDDIRTPTLQHI
YAFFTSTRNEQVINRIV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgtttaatagtgctcaattacaccaattcgccgctcaatacccgttgcaatat
ctcaacgggaaaaacggctgtcgactggcatatcgtcattttattcatcatccgacggcg
cgtgagttggtgatcatggtgaatggtcgggcggaaaatattttgaaatggacggaactg
gcttacgatttttatcaacaaggctatgatgtactggtttttgaccatcgcggacaaggt
tattcccaacgtttattgaaagacggcgaaaaaggtcatttagatgagtttcgtttttat
gctgaagatatggcagaaattatcgacaatctgaccgcactttatccttatcccaaccaa
tatattttggcccattccctcggcgctttagtcacaacctattatttggcaaatttcgac
cacagaattcaacgtgcggtgttttctgcaccattttttggcgtgccgttaaaacagccc
gtacgtgatgaaattctgttaaacatgatgatgttgtgggggcaaggagaacgctatgtg
ttcggcaaaggaccatataaacccgctaacctacaggaaaataacctcagccatgatgcc
acgcgaatgcagtggatgaatgaagtgaatttagccaatccggatattcgtttgggcgga
ccgacgttccgctgggtacatttatgtttaaatgcgataaaacatctgccgaaaatcatt
cgtcgggtagaaacgccggtattagtgttggaagcggaagaggaaaagatcgtgaacaat
aaaacgttggaaaaactgaccgcactttttgctcatgggcgcctgcgcaaaatcgcccgc
gccaaacatgaaatcctgtttgaaaccgacgatattcgcacgccgacgttgcagcatatt
tatgcgttttttacttcaacacgtaacgaacaagtaataaaccgaatagtgtaa

DBGET integrated database retrieval system