KEGG   Aggregatibacter aphrophilus NJ8700: NT05HA_1786Help
Entry
NT05HA_1786       CDS       T00929                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aap  Aggregatibacter aphrophilus NJ8700
Pathway
aap00040  Pentose and glucuronate interconversions
aap00052  Galactose metabolism
aap00500  Starch and sucrose metabolism
aap00520  Amino sugar and nucleotide sugar metabolism
aap01100  Metabolic pathways
aap01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NT05HA_1786
   00052 Galactose metabolism
    NT05HA_1786
   00500 Starch and sucrose metabolism
    NT05HA_1786
   00520 Amino sugar and nucleotide sugar metabolism
    NT05HA_1786
Enzymes [BR:aap01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NT05HA_1786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 CoA_binding SpoIIID
Motif
Other DBs
NCBI-ProteinID: ACS98113
Position
complement(1772542..1773429)
Genome map
AA seq 295 aa AA seqDB search
MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAGIKEIVLVTHSSKNAI
ENHFDTSFELETMLEKRVKRQLLEEVRSIVPKNVTIMHVRQGNAKGLGHAVLCGRPLVGN
EPFAVVLPDVLLAEFSANQKKENLSAMLKRFKQTQASQIMVSPVKPEEVSSYGIADCGGV
EIPPGESAKIDNIVEKPSIDEAPSNLAVVGRYVFSAAIWDLLEKTPVGVGDEIQLTDAID
MLIDQETVEAFHMTGVSYDCGDKIGYMKAFVEYGLHHNKLSGEFKSYLKDLVKTL
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgattattcctgtcgcaggcttaggtacgcgtatgttacctgcaactaaagca
attccaaaagagatgttaactttagtggataaaccgctcattcaatatgtggtaaatgaa
tgtgttgcagcgggcattaaagaaattgtgttggtgacccattcttccaaaaatgccatt
gaaaaccattttgatacttcctttgagttggaaaccatgttggaaaaacgcgttaagcgt
cagctcttggaagaagttcgttctattgtgccgaaaaacgtaacaattatgcatgtccgc
caaggcaatgcgaaaggtttggggcacgcggtattatgtggtcgcccgttggtaggcaat
gaaccttttgccgtagtattgccagatgtgttactcgccgaattttctgccaatcagaaa
aaagaaaatttatcagccatgctaaaacgctttaagcaaactcaggccagccaaatcatg
gtgagtccggttaaacctgaagaagtcagcagttatggtatcgccgattgcggtggcgtt
gaaattcctccgggtgaaagtgccaaaattgataacattgtggaaaaaccgagtatagac
gaagcgccatctaatttggcagttgtcggtcgttatgtgttctctgcggcgatttgggat
ttattggaaaaaactccggttggtgtgggggatgaaattcagttaactgatgcgattgat
atgcttattgaccaagaaaccgtggaggcattccacatgaccggtgtctcttacgattgc
ggcgataaaatcggttatatgaaagccttcgttgaatatggtttgcaccataataaactt
tccggtgagttcaaatcttatttgaaagatttggtaaaaacgctttaa

DBGET integrated database retrieval system