KEGG   Aggregatibacter aphrophilus: NT05HA_2090Help
Entry
NT05HA_2090       CDS       T00929                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
aap  Aggregatibacter aphrophilus
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:aap00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    NT05HA_2090
Enzymes [BR:aap01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     NT05HA_2090
Transfer RNA biogenesis [BR:aap03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    NT05HA_2090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2057501..2058310
Genome map
AA seq 269 aa AA seqDB search
MPILTTHLLQDVIDIAQQAGEHLRRFYQDSVVVHMKEDNTPVTEADMFVSQFLTEKLTAL
TPDIPILSEENCQIPLEERSRWQSYWLIDPLDGTQQFINRTDQFSILISLVKNGQPVLGV
IYAPILECTYYAMQGFGAYKKTAEQHIKLTFRDIEPNRALRIAVGSSSAAEKVRSILNKN
FDYEFHIFGSSGLKSTMVADGQCDCYIRLGLTGEWDTAAAEILLSEMGGVVFDLNYQALT
YNQRESFVNPNFIMVATQDFAWEKIFRSD
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcctatactcacgacgcatttattgcaggatgtaatagatatcgcccaacaggcgggt
gagcatttacgtcgcttttatcaagattccgtcgtagttcatatgaaagaggataatacc
ccggtgacagaagcggatatgtttgttagtcagtttttaacggaaaaactgaccgcactt
acacctgatattcctattttgtctgaagaaaattgtcaaattccgctggaagagcgtagt
cggtggcaatcttattggcttattgatccccttgatggcacgcagcaatttattaatcgt
accgatcaattctctattttaattagcctggtaaagaacggccaaccggtgttaggcgtt
atttatgcgccaatattggagtgcacatactacgccatgcaaggttttggtgcgtataaa
aaaacggcggaacagcacattaaactgacatttcgcgacatcgaaccgaaccgagcctta
cgtattgccgtaggctcttcctccgcggcagaaaaagtgcggtcgattttgaacaagaat
tttgactatgaatttcatattttcggctccagtggactgaaaagcaccatggtggcggat
gggcaatgtgattgctacatccgtctgggtttaaccggcgaatgggacactgcggcggca
gaaattttattgtcggaaatgggcggtgtggttttcgatttgaattatcaagccttaacc
tataaccaacgcgaatcttttgtgaatccgaattttattatggtggcgacgcaggatttt
gcttgggaaaaaatctttcgctccgattaa

DBGET integrated database retrieval system