KEGG   Acetohalobium arabaticum: Acear_0032Help
Entry
Acear_0032        CDS       T01290                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aar  Acetohalobium arabaticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aar00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Acear_0032
DNA repair and recombination proteins [BR:aar03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Acear_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35600..36205
Genome map
AA seq 201 aa AA seqDB search
MKYYAKPIAKLIGKLTKLPGIGPKSAQRLAFYIMNDSDEEVEELVDAIKDVKDRIDYCEV
CNNLTEHERCNICSNDERNRSVICIVESPKDIIAMEKTGEYNGLYHVLHGSISPMEGVGP
DDIEIKGLLSRIEDEDEEVEEVILATDPNVEGEATAMYIARLLKPLGITASRIAHGLPVG
GDLEYADEVTLSKALEGRKQV
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattatgcaaaaccgatcgcaaaattaattggtaaattaactaagttgcctggt
attggacctaaaagtgcacaacgattagccttttatattatgaatgattctgatgaggaa
gttgaagagttggttgatgctattaaagatgttaaggacaggatagattactgtgaagta
tgtaataacttaactgagcatgaacgctgtaatatctgtagcaatgatgaacggaatcga
tctgttatctgtatagttgaaagtcctaaagatataattgctatggaaaagacaggagaa
tataatggcctttatcatgtcttgcatggttctatatctcccatggaaggtgtaggtcct
gatgatattgagattaaaggattattatcaaggattgaagatgaggatgaagaggtagaa
gaggttattttagctacggaccctaatgtggaaggggaagcaactgcaatgtatattgcc
cgcctactaaagccgttaggtattactgctagtagaatagcccatggtctaccggtaggt
ggagatttggagtatgctgatgaagttaccctttctaaagctttagagggtaggaaacaa
gtataa

DBGET integrated database retrieval system