KEGG   Acetohalobium arabaticum: Acear_0034Help
Entry
Acear_0034        CDS       T01290                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
aar  Acetohalobium arabaticum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acear_0034
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_0034
   00020 Citrate cycle (TCA cycle)
    Acear_0034
   00620 Pyruvate metabolism
    Acear_0034
   00640 Propanoate metabolism
    Acear_0034
   00650 Butanoate metabolism
    Acear_0034
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Acear_0034
   00680 Methane metabolism
    Acear_0034
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Acear_0034
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Acear_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
36999..37574
Genome map
AA seq 191 aa AA seqDB search
MANLTEIRWHGRGGQGAKTASILLGKVASKTGKNIQAFPEYGPERMGAPVLAFNRISDEE
LTVHCQVTEPSIVTVLDPTLLEAVDVTEGIPADGKIIINTTKSPTDVKKELDFEGEVYTV
DADGISTDEIGAAFPNTPMLGALVKVTDLLEFDNFKEQVEKEFKKKFASKPEVIDGNMKS
IERAYQEVKSE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatttaacagaaattcgctggcatggtcgtggaggacagggtgctaagacagca
tctattctattaggcaaggttgcttcaaaaactggcaagaatattcaagcatttccagag
tatggtccagaaagaatgggggcaccagtattagcattcaataggattagtgatgaggaa
cttacagttcactgtcaggttactgaaccgagtatagtgactgttttagatcctacttta
ctggaagctgttgatgtaactgaaggtataccagctgacggtaaaattattattaatacc
actaaatctccaaccgatgttaagaaggaattagactttgagggagaagtatatactgtt
gatgctgatggtatctctactgatgaaattggagctgcttttcctaatactccaatgttg
ggggcattagtaaaggtaactgatttattggaatttgataacttcaaagaacaggttgag
aaggaattcaaaaagaagtttgctagtaagcctgaagttattgatggtaatatgaaatca
attgaacgggcttaccaggaggtgaagagtgaataa

DBGET integrated database retrieval system