KEGG   Acetohalobium arabaticum: Acear_0034Help
Entry
Acear_0034        CDS       T01290                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, gamma subunit
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00010  Glycolysis / Gluconeogenesis
aar00020  Citrate cycle (TCA cycle)
aar00620  Pyruvate metabolism
aar00633  Nitrotoluene degradation
aar00640  Propanoate metabolism
aar00650  Butanoate metabolism
aar00680  Methane metabolism
aar00720  Carbon fixation pathways in prokaryotes
aar01100  Metabolic pathways
aar01120  Microbial metabolism in diverse environments
aar01130  Biosynthesis of antibiotics
aar01200  Carbon metabolism
Module
aar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_0034
   00020 Citrate cycle (TCA cycle)
    Acear_0034
   00620 Pyruvate metabolism
    Acear_0034
   00640 Propanoate metabolism
    Acear_0034
   00650 Butanoate metabolism
    Acear_0034
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Acear_0034
   00680 Methane metabolism
    Acear_0034
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Acear_0034
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Acear_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ADL11586
UniProt: D9QSP8
Position
36999..37574
Genome map
AA seq 191 aa AA seqDB search
MANLTEIRWHGRGGQGAKTASILLGKVASKTGKNIQAFPEYGPERMGAPVLAFNRISDEE
LTVHCQVTEPSIVTVLDPTLLEAVDVTEGIPADGKIIINTTKSPTDVKKELDFEGEVYTV
DADGISTDEIGAAFPNTPMLGALVKVTDLLEFDNFKEQVEKEFKKKFASKPEVIDGNMKS
IERAYQEVKSE
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatttaacagaaattcgctggcatggtcgtggaggacagggtgctaagacagca
tctattctattaggcaaggttgcttcaaaaactggcaagaatattcaagcatttccagag
tatggtccagaaagaatgggggcaccagtattagcattcaataggattagtgatgaggaa
cttacagttcactgtcaggttactgaaccgagtatagtgactgttttagatcctacttta
ctggaagctgttgatgtaactgaaggtataccagctgacggtaaaattattattaatacc
actaaatctccaaccgatgttaagaaggaattagactttgagggagaagtatatactgtt
gatgctgatggtatctctactgatgaaattggagctgcttttcctaatactccaatgttg
ggggcattagtaaaggtaactgatttattggaatttgataacttcaaagaacaggttgag
aaggaattcaaaaagaagtttgctagtaagcctgaagttattgatggtaatatgaaatca
attgaacgggcttaccaggaggtgaagagtgaataa

DBGET integrated database retrieval system