KEGG   Acetohalobium arabaticum: Acear_0035Help
Entry
Acear_0035        CDS       T01290                                 

Definition
(GenBank) pyruvate ferredoxin/flavodoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00010  Glycolysis / Gluconeogenesis
aar00020  Citrate cycle (TCA cycle)
aar00620  Pyruvate metabolism
aar00633  Nitrotoluene degradation
aar00640  Propanoate metabolism
aar00650  Butanoate metabolism
aar00680  Methane metabolism
aar00720  Carbon fixation pathways in prokaryotes
aar01100  Metabolic pathways
aar01120  Microbial metabolism in diverse environments
aar01130  Biosynthesis of antibiotics
aar01200  Carbon metabolism
Module
aar_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_0035
   00020 Citrate cycle (TCA cycle)
    Acear_0035
   00620 Pyruvate metabolism
    Acear_0035
   00640 Propanoate metabolism
    Acear_0035
   00650 Butanoate metabolism
    Acear_0035
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Acear_0035
   00680 Methane metabolism
    Acear_0035
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Acear_0035
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Acear_0035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_7 Fer4_16 Fer4_9 Fer4_17 Fer4_6 Fer4_10 Fer4_2 Fer4_8 Fer4_13 Fer4_22 Fer4_4 Fer4_15
Motif
Other DBs
NCBI-ProteinID: ADL11587
UniProt: D9QSP9
Position
37574..37885
Genome map
AA seq 103 aa AA seqDB search
MAAKKDAQKPGWKEVPEGGLILEAGNATEYKTGGWRTHRPELDIDQCINCHRCWIYCPDS
AIVSEDEEVTGFDHDYCKGCGICAHECPVDAISMIKEEPSTEE
NT seq 312 nt NT seq  +upstreamnt  +downstreamnt
atggctgctaaaaaagatgctcaaaaacccggttggaaggaagttccagaaggcggtttg
atcttagaagcaggtaatgctactgagtataagactggaggctggagaactcatcgtcca
gaattggatatagatcagtgtattaattgtcatcgctgctggatttattgtccagattct
gctattgtttctgaagatgaagaagttactggattcgatcatgattattgtaaaggctgt
ggaatttgtgctcatgaatgtcctgttgatgctatttctatgattaaagaggagccatca
actgaagaataa

DBGET integrated database retrieval system