KEGG   Acetohalobium arabaticum: Acear_0037Help
Entry
Acear_0037        CDS       T01290                                 

Definition
thiamine pyrophosphate domain-containing TPP-binding protein
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
aar  Acetohalobium arabaticum
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acear_0037
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_0037
   00020 Citrate cycle (TCA cycle)
    Acear_0037
   00620 Pyruvate metabolism
    Acear_0037
   00640 Propanoate metabolism
    Acear_0037
   00650 Butanoate metabolism
    Acear_0037
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Acear_0037
   00680 Methane metabolism
    Acear_0037
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Acear_0037
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Acear_0037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
39100..40032
Genome map
AA seq 310 aa AA seqDB search
MSKVNLKELSHQDERLTGGHRLCSGCGASIIVRQILHATQDPVVVGCATGCLEVSTTIYP
YTAWKDSFIHNAFENSAATVSGVEAAYRSLKKQGKIDEETKFLAFGGDGGTYDIGFQSLS
GAMERGHDMVYVCYDNGAYMNTGIQRSSATPRNASTTTSPAGEVIPGKQQFRKELTDIVA
AHNIPYVAQASPHKFKDLVRKAKKAFEVEGPAFLNVLSPCPRGWRYPEDEAMDLLRSATD
SCFWPLYECEDGEWKLNYKPKEKAPITDWLKPQGRFKHVFKEGNEHLVDEIQEHVDQRWE
TILHRCGETE
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagttaatttaaaagaattatcacatcaggatgaaaggttgaccggtggacat
agattatgttcaggatgtggagcttcaattattgtgcgacagattttacatgccacacaa
gatccagtggtagttggttgtgcaacaggttgtcttgaggtttcaactactatttatcct
tatactgcttggaaagactctttcattcataatgcttttgaaaattctgctgcaactgtt
agtggtgtagaagctgcttatcgttctttaaagaagcagggtaagatcgatgaagagaca
aagtttttagcttttggtggtgatggtggaacttacgatatcggtttccaatcactttct
ggagctatggaacgtgggcatgacatggtttatgtctgttatgataacggtgcttatatg
aatactggtattcagcgttccagtgctacacctagaaatgctagtacaacaactagtcca
gctggagaagtaattcctggtaagcagcagtttagaaaagagttgactgatatagttgct
gctcataacattccttatgttgcccaggcttcaccacataagtttaaggatttagtacga
aaagctaaaaaagcctttgaagtagaaggaccggccttcttgaatgtattatctccatgt
ccaagaggatggagatatccagaagatgaggctatggatctattgagatcagctacagat
agctgtttctggccgttatatgagtgtgaagatggtgagtggaagttaaattacaagccg
aaagaaaaggctccaattactgattggttaaagccgcagggtagatttaagcatgtcttt
aaagaaggtaatgagcatttagttgatgagatccaagaacatgttgaccagagatgggaa
acaattcttcaccgctgtggagaaactgaataa

DBGET integrated database retrieval system