KEGG   Acetohalobium arabaticum: Acear_0197Help
Entry
Acear_0197        CDS       T01290                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00220  Arginine biosynthesis
aar00330  Arginine and proline metabolism
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
aar01130  Biosynthesis of antibiotics
aar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Acear_0197
   00330 Arginine and proline metabolism
    Acear_0197
Enzymes [BR:aar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Acear_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase VirE2
Motif
Other DBs
NCBI-ProteinID: ADL11748
UniProt: D9QTI4
Position
200121..201011
Genome map
AA seq 296 aa AA seqDB search
MKIGIIGVPMDLGASRRGVDMGPSAVRYAHLAARIEELGLEVTDFGDIDVPVIRSELENI
DRSNFIPEIRDVCTSLSKKVQEIMIKGFIPLVIGGDHSIAIGTFGGVANAGKNVGLLWFD
AHGDFNNLTTSQTGNPHGMPLAVINSDGPEDLVSITEGYDLCEDNIALVGIRDLDYKERQ
RLKDTDIDVYTISDIDRQGIEEILEKAIQSAGCGTEGVHVSFDVDVLDPLTAPGVGTAVP
GGLDYREAHLALEMIAEAGVLASLELVEVNPILDERNRTAELAVELILSCLGKNIL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattggaattattggcgttcctatggacttaggtgctagtcgacgaggagtagat
atgggacctagtgctgttagatatgctcatctagctgctagaattgaggagcttggatta
gaggtaactgattttggtgatatagatgttccggtgattaggagtgagctggagaatata
gacagaagtaactttattcctgaaattagagatgtctgtacttctttaagtaagaaggta
caggaaataatgataaaaggcttcattcctttagttattggtggggatcacagtattgct
attggtacttttggtggtgtagctaatgctggtaagaatgtaggattactctggtttgat
gctcatggagattttaataatttgactactagtcaaacgggtaatcctcacggaatgccg
ctggctgttattaatagtgatggtcctgaagatttagtttctataactgagggttatgat
ttatgtgaagataatatagccttggttggaattagggatctggattataaggaaaggcag
agactaaaggatactgatatagatgtatatacaatcagtgatatagaccggcagggtata
gaggagatactggagaaggcaattcagtctgctggctgtggtacggaaggagtccatgtc
agctttgatgtagatgtcttggatccattgactgcaccgggagtaggtacagcagtgccg
ggcgggcttgattatcgagaggcacatctagccttagagatgattgccgaggctggagtt
ttggcttcactggaattagtagaggttaatcctattttggatgaacgaaacaggacggca
gagttagctgtagaattaattttatcctgtttaggaaagaatattctataa

DBGET integrated database retrieval system