KEGG   Acetohalobium arabaticum: Acear_0197Help
Entry
Acear_0197        CDS       T01290                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aar  Acetohalobium arabaticum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aar01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aar00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200121..201011
Genome map
AA seq 296 aa AA seqDB search
MKIGIIGVPMDLGASRRGVDMGPSAVRYAHLAARIEELGLEVTDFGDIDVPVIRSELENI
DRSNFIPEIRDVCTSLSKKVQEIMIKGFIPLVIGGDHSIAIGTFGGVANAGKNVGLLWFD
AHGDFNNLTTSQTGNPHGMPLAVINSDGPEDLVSITEGYDLCEDNIALVGIRDLDYKERQ
RLKDTDIDVYTISDIDRQGIEEILEKAIQSAGCGTEGVHVSFDVDVLDPLTAPGVGTAVP
GGLDYREAHLALEMIAEAGVLASLELVEVNPILDERNRTAELAVELILSCLGKNIL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattggaattattggcgttcctatggacttaggtgctagtcgacgaggagtagat
atgggacctagtgctgttagatatgctcatctagctgctagaattgaggagcttggatta
gaggtaactgattttggtgatatagatgttccggtgattaggagtgagctggagaatata
gacagaagtaactttattcctgaaattagagatgtctgtacttctttaagtaagaaggta
caggaaataatgataaaaggcttcattcctttagttattggtggggatcacagtattgct
attggtacttttggtggtgtagctaatgctggtaagaatgtaggattactctggtttgat
gctcatggagattttaataatttgactactagtcaaacgggtaatcctcacggaatgccg
ctggctgttattaatagtgatggtcctgaagatttagtttctataactgagggttatgat
ttatgtgaagataatatagccttggttggaattagggatctggattataaggaaaggcag
agactaaaggatactgatatagatgtatatacaatcagtgatatagaccggcagggtata
gaggagatactggagaaggcaattcagtctgctggctgtggtacggaaggagtccatgtc
agctttgatgtagatgtcttggatccattgactgcaccgggagtaggtacagcagtgccg
ggcgggcttgattatcgagaggcacatctagccttagagatgattgccgaggctggagtt
ttggcttcactggaattagtagaggttaatcctattttggatgaacgaaacaggacggca
gagttagctgtagaattaattttatcctgtttaggaaagaatattctataa

DBGET integrated database retrieval system