KEGG   Acetohalobium arabaticum: Acear_0197Help
Entry
Acear_0197        CDS       T01290                                 

Definition
arginase (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aar  Acetohalobium arabaticum
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acear_0197
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Acear_0197
Enzymes [BR:aar01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Acear_0197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
200121..201011
Genome map
AA seq 296 aa AA seqDB search
MKIGIIGVPMDLGASRRGVDMGPSAVRYAHLAARIEELGLEVTDFGDIDVPVIRSELENI
DRSNFIPEIRDVCTSLSKKVQEIMIKGFIPLVIGGDHSIAIGTFGGVANAGKNVGLLWFD
AHGDFNNLTTSQTGNPHGMPLAVINSDGPEDLVSITEGYDLCEDNIALVGIRDLDYKERQ
RLKDTDIDVYTISDIDRQGIEEILEKAIQSAGCGTEGVHVSFDVDVLDPLTAPGVGTAVP
GGLDYREAHLALEMIAEAGVLASLELVEVNPILDERNRTAELAVELILSCLGKNIL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
ttgaagattggaattattggcgttcctatggacttaggtgctagtcgacgaggagtagat
atgggacctagtgctgttagatatgctcatctagctgctagaattgaggagcttggatta
gaggtaactgattttggtgatatagatgttccggtgattaggagtgagctggagaatata
gacagaagtaactttattcctgaaattagagatgtctgtacttctttaagtaagaaggta
caggaaataatgataaaaggcttcattcctttagttattggtggggatcacagtattgct
attggtacttttggtggtgtagctaatgctggtaagaatgtaggattactctggtttgat
gctcatggagattttaataatttgactactagtcaaacgggtaatcctcacggaatgccg
ctggctgttattaatagtgatggtcctgaagatttagtttctataactgagggttatgat
ttatgtgaagataatatagccttggttggaattagggatctggattataaggaaaggcag
agactaaaggatactgatatagatgtatatacaatcagtgatatagaccggcagggtata
gaggagatactggagaaggcaattcagtctgctggctgtggtacggaaggagtccatgtc
agctttgatgtagatgtcttggatccattgactgcaccgggagtaggtacagcagtgccg
ggcgggcttgattatcgagaggcacatctagccttagagatgattgccgaggctggagtt
ttggcttcactggaattagtagaggttaatcctattttggatgaacgaaacaggacggca
gagttagctgtagaattaattttatcctgtttaggaaagaatattctataa

DBGET integrated database retrieval system