KEGG   Acetohalobium arabaticum: Acear_0209Help
Entry
Acear_0209        CDS       T01290                                 

Definition
3-isopropylmalate dehydratase large subunit (EC:4.2.1.33)
Orthology
K01703  
3-isopropylmalate/(R)-2-methylmalate dehydratase large subunit [EC:4.2.1.33 4.2.1.35]
Organism
aar  Acetohalobium arabaticum
Pathway
Valine, leucine and isoleucine biosynthesis
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Leucine biosynthesis, 2-oxoisovalerate => 2-oxoisocaproate
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Acear_0209
   01230 Biosynthesis of amino acids
    Acear_0209
  Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    Acear_0209
  Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    Acear_0209
Enzymes [BR:aar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.33  3-isopropylmalate dehydratase
     Acear_0209
    4.2.1.35  (R)-2-methylmalate dehydratase
     Acear_0209
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
216775..218037
Genome map
AA seq 420 aa AA seqDB search
MGMTMVEKILADHAGREEVQPGELINARLDIVLGNDVTTPVAIKEFDKIGVDEVFDKERV
VIVPDHFAPNKDINSAEQCKFIRGFAEEKELVNYFEIGEMGIEHCLLPEQGLVLPGDAVI
GADSHTCTYGALGAFATGVGSTDMAAGMATGEAWFKVPETIKFVYNGELNDWVGGKDLIL
YTIGDIGVDGALYKAMEFTGEVIENLPMDHRFTMSNMAIEAGGKCGLIEPDQTTIDYVED
RAQRDYKLYQSDEDAEYDEIIEYDVSQIEPQVAFPHLPENTRGISEVGEVEIDQAVIGSC
TNGRLGDLRLAAKVLEGKKAADNVRLIVFPGTQEIYKQAMKEGLIETLIDAGAAVSTPTC
GPCLGGHMGILAEGERAIATTNRNFVGRMGHPESEVYLSNPAVAAASAIKGKIVSPKEVI
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgggaatgacaatggtagaaaagattttagctgaccatgctggaagagaagaggttcag
cctggagaattaattaatgccaggctggatattgttctcggtaatgatgtaactactcct
gtggccatcaaggaatttgataagataggtgtagatgaggtattcgataaagaacgggta
gtaattgtacctgatcattttgctcctaataaggatattaattcagctgagcagtgtaag
tttattagaggctttgctgaggagaaagaattagttaattactttgaaatcggtgagatg
ggaattgaacactgtcttttaccggaacagggtttagttctgccgggggatgcagttatt
ggagctgactcccatacctgcacttatggtgctctaggagcctttgctactggtgtagga
agtacagatatggccgccggtatggctactggtgaagcctggtttaaagtaccggagaca
attaagtttgtctataatggtgaactgaatgactgggtcggcggtaaagacttgattcta
tatactatcggtgatatcggagtcgacggcgcattatataaggcaatggagtttaccggt
gaagtgattgagaatttaccgatggatcaccgctttactatgtccaatatggctattgag
gccggcggtaagtgcggtttgattgagccggatcagacgactatagattatgtagaggat
agagcccagcgtgattataaactctatcagagcgatgaagatgcagagtatgatgagata
attgagtatgatgtcagccagatagagccacaggtggccttccctcatttacctgaaaac
acaagaggtatcagtgaagtaggcgaggtagagatcgatcaggcggtaatcggttcctgt
accaatggacggcttggtgatctgcgtttggctgctaaggtactggaaggaaagaaagca
gctgataatgttaggttgattgtcttccctggtacgcaggagatctataagcaggctatg
aaagaaggcttaatcgagaccttgattgatgctggcgctgctgtcagtacaccaacctgc
ggcccttgtttaggcggacatatgggaattttagctgaaggtgaacgggcaattgcgact
actaaccgtaactttgtgggccggatgggccatccagaaagcgaagtctatctgtccaat
ccagcagtggctgcggcatcggctatcaaaggaaaaattgtcagtccgaaggaggtaata
tag

DBGET integrated database retrieval system