KEGG   Acetohalobium arabaticum: Acear_0306Help
Entry
Acear_0306        CDS       T01290                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
aar  Acetohalobium arabaticum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acear_0306
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_0306
   00052 Galactose metabolism
    Acear_0306
   00500 Starch and sucrose metabolism
    Acear_0306
   00520 Amino sugar and nucleotide sugar metabolism
    Acear_0306
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Acear_0306
   00524 Butirosin and neomycin biosynthesis
    Acear_0306
Enzymes [BR:aar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Acear_0306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
330060..331031
Genome map
AA seq 323 aa AA seqDB search
MAGYVIGVDLGGTKILTVLANLQGEIIAKKRSATKSEQGAEKVIDRILTTIDQVLADSDL
TIDEIEAIGVGAPGPLSVKEGIIHHAPNLGWKDLNLKQLLESELNIPVFIENDANTAALG
SKWFGAGKDKQNMIYLTVSTGIGSGIIIDNKLYHGISDSAGEVGHMVLDPESDVRCRCGD
YGCWEALASGTALGRLGQKAVSSSSYSLMEELVDSTDQIDGAVVTEAAAQGDKTAKKILN
QVTNYLGIGIANLLNILNPELIVVGGGVSQAGDIVLEPVREIALKRAMETPAKEVEIVRT
QLGDNIGAIGAVAKALTQLGILN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
gtggctggatatgtaattggagttgatttaggcggtactaagatattgacagttctagcc
aatctgcagggagagattatagcaaagaagagatcggctactaaaagcgaacagggtgca
gagaaggtaatcgaccgtatattaactactattgaccaggttcttgctgattctgatcta
actatagacgaaatagaggctataggagttggagctccagggccgttgagtgtaaaagaa
ggaattattcatcacgcacccaatctaggctggaaggatcttaatttaaagcagttgctg
gaatcggaattgaatattccggtctttattgagaatgatgccaatacagcagctttaggg
agtaagtggtttggagctggtaaggataagcagaatatgatctatcttacagttagtacc
ggaattggcagcggaattattattgataataaattataccacggtattagtgatagtgcc
ggagaagtaggccatatggtgcttgatcctgagtcggatgtcagatgccgctgtggggac
tacggctgctgggaagcccttgcctccggtactgctttgggaagattaggccaaaaagca
gtaagctccagcagttattcactaatggaagaattagttgacagtactgaccagatcgat
ggagcagtagttactgaagcagcagctcagggtgataagacagctaaaaagattttaaac
caagtaactaattatttaggaatcggtattgctaatttacttaatatcttaaatccagag
ttgatagtggtcggtggcggtgtttctcaagcaggtgatatagttttagaaccggttaga
gagatagcattaaaacgggctatggagaccccggctaaagaagttgaaatagttcgaacc
cagctaggagataatataggagccataggagcagttgctaaagcattaactcagcttgga
attttaaattaa

DBGET integrated database retrieval system