KEGG   Acetohalobium arabaticum: Acear_0324Help
Entry
Acear_0324        CDS       T01290                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aar  Acetohalobium arabaticum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acear_0324
   01230 Biosynthesis of amino acids
    Acear_0324
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_0324
   00051 Fructose and mannose metabolism
    Acear_0324
   00562 Inositol phosphate metabolism
    Acear_0324
Enzymes [BR:aar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acear_0324
Exosome [BR:aar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acear_0324
  Exosomal proteins of bladder cancer cells
   Acear_0324
  Exosomal proteins of melanoma cells
   Acear_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
350939..351688
Genome map
AA seq 249 aa AA seqDB search
MRQPFIAGNWKMHKTNQEAVEMVEELVDLVGDIGDVDIAICAPATALAPLSEVTAGTNIA
LGAEDMHWEEEGAYTGEISPLMLKDVGCEYVILGHSERRDYFGETDEDVNKKVQTALKHS
LKPIICVGESLAQREAEGTKDVVKNQVLAALDGVNIDDLKVITIAYEPLWAIGTGKSAST
KEANEVIKYIRNVLRNEFGKVADSMRIQYGGSVKPHNISEFMATSDIDGALVGSASLEAQ
SFADIVKFE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaaccatttattgctggtaactggaagatgcataagactaatcaagaagcagtg
gaaatggtggaagaattagtagacttagttggagatataggcgatgtagatattgctatc
tgtgcacctgctactgctttggcaccgcttagtgaagtgacggctggaactaatattgcg
ttgggtgctgaagatatgcactgggaagaagaaggagcctataccggtgaaatctcacca
ttaatgcttaaagatgtcggttgtgaatatgtaattttaggccactcagaacggagagat
tacttcggcgaaactgatgaagatgtcaataagaaggtgcagactgctttaaaacacagc
ctaaagccgattatttgtgtaggtgaatctctagcccagagagaagctgaagggactaag
gatgtagttaaaaatcaggttttagctgctttagatggagtaaacatagatgatctaaaa
gtaattacgattgcttatgaaccgctgtgggcgattgggactggtaaatcagctagtaca
aaagaagctaatgaggtgattaaatatattagaaatgtgctgcgtaatgaatttggtaaa
gtagctgatagcatgcggattcaatacggcggcagtgtaaagccgcataatatttctgaa
tttatggctacttcagatattgatggtgctttggtaggaagtgccagtcttgaggcccaa
tcttttgcagatatagtcaagtttgagtaa

DBGET integrated database retrieval system