KEGG   Acetohalobium arabaticum: Acear_0324Help
Entry
Acear_0324        CDS       T01290                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00010  Glycolysis / Gluconeogenesis
aar00051  Fructose and mannose metabolism
aar00562  Inositol phosphate metabolism
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
aar01120  Microbial metabolism in diverse environments
aar01130  Biosynthesis of antibiotics
aar01200  Carbon metabolism
aar01230  Biosynthesis of amino acids
Module
aar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aar_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_0324
   00051 Fructose and mannose metabolism
    Acear_0324
   00562 Inositol phosphate metabolism
    Acear_0324
Enzymes [BR:aar01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Acear_0324
Exosome [BR:aar04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Acear_0324
  Exosomal proteins of bladder cancer cells
   Acear_0324
  Exosomal proteins of melanoma cells
   Acear_0324
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM AAA PaRep2b T4_tail_cap
Motif
Other DBs
NCBI-ProteinID: ADL11873
UniProt: D9QU80
Position
350939..351688
Genome map
AA seq 249 aa AA seqDB search
MRQPFIAGNWKMHKTNQEAVEMVEELVDLVGDIGDVDIAICAPATALAPLSEVTAGTNIA
LGAEDMHWEEEGAYTGEISPLMLKDVGCEYVILGHSERRDYFGETDEDVNKKVQTALKHS
LKPIICVGESLAQREAEGTKDVVKNQVLAALDGVNIDDLKVITIAYEPLWAIGTGKSAST
KEANEVIKYIRNVLRNEFGKVADSMRIQYGGSVKPHNISEFMATSDIDGALVGSASLEAQ
SFADIVKFE
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgcggcaaccatttattgctggtaactggaagatgcataagactaatcaagaagcagtg
gaaatggtggaagaattagtagacttagttggagatataggcgatgtagatattgctatc
tgtgcacctgctactgctttggcaccgcttagtgaagtgacggctggaactaatattgcg
ttgggtgctgaagatatgcactgggaagaagaaggagcctataccggtgaaatctcacca
ttaatgcttaaagatgtcggttgtgaatatgtaattttaggccactcagaacggagagat
tacttcggcgaaactgatgaagatgtcaataagaaggtgcagactgctttaaaacacagc
ctaaagccgattatttgtgtaggtgaatctctagcccagagagaagctgaagggactaag
gatgtagttaaaaatcaggttttagctgctttagatggagtaaacatagatgatctaaaa
gtaattacgattgcttatgaaccgctgtgggcgattgggactggtaaatcagctagtaca
aaagaagctaatgaggtgattaaatatattagaaatgtgctgcgtaatgaatttggtaaa
gtagctgatagcatgcggattcaatacggcggcagtgtaaagccgcataatatttctgaa
tttatggctacttcagatattgatggtgctttggtaggaagtgccagtcttgaggcccaa
tcttttgcagatatagtcaagtttgagtaa

DBGET integrated database retrieval system