KEGG   Acetohalobium arabaticum: Acear_0702Help
Entry
Acear_0702        CDS       T01290                                 

Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
aar  Acetohalobium arabaticum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aar00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Acear_0702
Enzymes [BR:aar01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Acear_0702
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
765169..765774
Genome map
AA seq 201 aa AA seqDB search
MIAHLTGELVLKEEARIVIDVQGVGYEVMIPTSVQNRLPNIGEDIKVYTHTYVREDRFVL
YGFLQLSELELFGKLLKVSKVGPKVAVSILSTLNAREFKLAVAKEDIEVLKEVKGIGKKT
AQRLILEMKGKIDLDRIMEEEESSQSVDGIEREEAVEGLMNLGYNIQEAREAVTEACKGV
DEAAGVEEVIKLALQKFGQND
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgatagcacatcttacaggggagttagtcctaaaagaggaagcacggattgtcattgat
gttcaaggagtaggttatgaagtgatgattcctacttcagtgcagaatcgtctgccgaat
ataggagaggatattaaagtatatacccatacctatgtgcgggaagatagatttgtctta
tatggttttttacagctgagcgaactggaactattcggaaaactattaaaggtttctaaa
gttggacctaaagtagcagtcagtattctatccactttaaatgctagagaattcaaactg
gcagtggctaaggaggatattgaggttttaaaagaggttaagggtatcggcaaaaagaca
gcccagagattaattctggagatgaagggtaagattgatttagatcggataatggaagaa
gaggaaagcagtcaatcagttgatggtatagagcgagaagaagcagtagaaggcttgatg
aatttaggttataatattcaagaggctcgtgaggcagtaactgaggcctgtaaaggtgta
gatgaagctgctggagtggaagaagttattaaattggctttacagaaatttggtcaaaat
gattag

DBGET integrated database retrieval system