KEGG   Acetohalobium arabaticum: Acear_0829Help
Entry
Acear_0829        CDS       T01290                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
aar  Acetohalobium arabaticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acear_0829
Enzymes [BR:aar01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Acear_0829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
898453..899940
Genome map
AA seq 495 aa AA seqDB search
MEFKRQSGILLHPTSLPGDYGIGSLGEEAYEFIDFLVAADQKLWQILPLGPTGYGDSPYQ
SFSAFAGNPLLISLERLKEDGLLAADDLKTEKEFALDYVDYDQVTEFKYPLFEKAFQTFK
RDAAKSIEDKFQRFCCENSDWLDDYALFKTLKECFEGQPWYEWDEDIKLRRSEAINHYQE
TLQDRIKFHKFIQYIFFKQWNRLKAYANENYIKIVGDIPIFVAYDSADVWANPELFSLDE
DKKPINVAGVPPDYFSETGQLWGNPLYDWQKLKETDYDWWIDRFETTLELVDIVRLDHFR
GFAAYWAVPYGEKTAVRGKWKEGPGRDFFRKVKDELKKLPIIAEDLGVITDEVEELRDYF
KLPGMNVLQFGFNSQDDNNHLPHNYTKNSVVYTGTHDNNTVLGWYNNADDEAREYAIEYL
KASEDNICWDFLQAAWASVSKIAIAPLQDILSLNSEARMNTPGTTKGNWKWRYRKEMLDV
NLSKKLKRLTGIYHR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggagtttaaaagacagagcggtattttattacatcccacttctctgccaggggattat
ggaatcggttctttaggtgaagaagcttatgaatttatagattttcttgttgctgcagac
cagaagttatggcagatacttccgttaggtccaaccggatatggagattctccataccag
tccttttcagcctttgctggtaatccattattgatcagtttagagcggcttaaggaagat
ggattattagcagcagatgatttgaagacagagaaagaatttgctctggattatgtagat
tatgatcaggtaactgagtttaagtatcctctatttgaaaaggccttccaaacgtttaaa
cgggatgctgcaaagtcgatcgaggataagtttcaacgtttctgttgtgagaacagcgac
tggttggatgattatgcactctttaagacacttaaagagtgctttgaggggcagccgtgg
tatgaatgggatgaagatatcaaattaagaaggtcggaagctataaaccattaccaggaa
actctgcaggatagaattaagtttcataaatttattcagtatatcttctttaaacagtgg
aatagattaaaagcctatgccaatgaaaattatattaagatagttggtgatattcctatc
tttgtagcctatgatagtgcagatgtctgggctaatcctgaactcttttctttagatgaa
gataagaagccgattaatgtagccggagtgcccccagattatttcagtgaaacaggacag
ttatggggtaatccattatatgattggcagaaattaaaagagaccgattatgactggtgg
atagatagatttgagacaaccttggaattagtggatattgttcgtttagaccattttaga
ggctttgctgcctactgggcagttccttatggagaaaagacagctgttagaggcaaatgg
aaagaagggccgggcagagacttctttagaaaggttaaagatgaattaaagaaactgcct
attattgctgaagatttaggtgtgattactgatgaagttgaggaattgagggattacttc
aagcttcccgggatgaatgttttacagtttggtttcaactctcaggatgataacaaccat
ctgccccataattatactaaaaattcagtagtttataccggaacccatgataataatact
gttttaggctggtataataatgctgatgatgaagctagagaatatgcaatagaatatcta
aaagctagtgaggataatatctgctgggattttctgcaggcagcctgggcttcagtatcc
aaaattgctattgcccctcttcaggatattctttcgttgaatagcgaggctagaatgaat
actccaggaactactaagggtaactggaagtggagatatagaaaagaaatgttggatgtt
aatttaagcaagaaactaaagagattaaccggaatataccatagataa

DBGET integrated database retrieval system