KEGG   Acetohalobium arabaticum: Acear_0895Help
Entry
Acear_0895        CDS       T01290                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aar  Acetohalobium arabaticum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aar00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aar00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
964950..965891
Genome map
AA seq 313 aa AA seqDB search
MSFKHKHLLDLMDLSREEIQLILDTAESMKEIFTRSIKKVPTLRGKTIISLFYEPSTRTK
SSFDLAGKRLSADMMSLSVSTSSVVKGESLVDTAKTMEAMGADAVIMRHSMPGAPHLLAE
SIDASVLNAGDGAHAHPTQALLDMYSIREERGKIAGETIAIVGDIKHSRVARSNIWALNK
LGAKVRVVGPPTLIPANLEEMDVEVYYDLEEGLEGIDVVNILRIQLERQEAGYLPNLREY
TKFYGVDEKILELVGDEVTVMHPGPTNRGVEITPEVAYGDQSVINEQVTNGVAIRMALLY
LLTGGEKIEETAN
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgagttttaagcataaacatcttctcgatttgatggatttaagcagagaagagattcag
ttaattctggatacagctgaatcaatgaaagagatctttacccgatcaattaagaaggtg
ccgacattaagagggaagacgattattagcctcttttatgaacccagtactcgaacaaag
tcatcatttgatctggccggcaagcggctgagtgctgatatgatgagtctgtcggtatca
acaagtagtgttgtaaaaggagagagcttggtcgatacagccaagacgatggaggctatg
ggggcagatgctgttattatgcgccatagtatgcctggagcgccgcatctactagcagaa
agtattgatgcatcggttctgaatgctggcgatggagctcatgcccatcctactcaagct
ctgttggatatgtatagtattcgcgaagaacggggaaaaatagcaggagagactattgct
attgtaggtgatatcaaacacagtagagtagcccgttcgaatatctgggctttgaataaa
ttaggagctaaggtaagagtggttggaccgccgactctgattccggccaacttggaggag
atggatgttgaggtttattatgatttagaagagggcttagaaggaatagatgtagtcaat
attctccggattcaattagaacgacaagaagcaggatacctacctaatctgcgggagtat
actaaattctacggtgtagatgagaaaatattggaattggttggtgacgaggttactgtg
atgcatcccgggccgaccaatcgtggagtagagattacaccggaagtagcttatggagac
caatcagtaattaatgaacaggtaaccaatggagtagctatcagaatggcactcctatat
ctcttaactgggggtgagaagattgaagagactgctaattaa

DBGET integrated database retrieval system