KEGG   Acetohalobium arabaticum: Acear_0899Help
Entry
Acear_0899        CDS       T01290                                 

Definition
carbamoyl-phosphate synthase large subunit
Orthology
K01955  
carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
aar  Acetohalobium arabaticum
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:aar00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:aar00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969270..972482
Genome map
AA seq 1070 aa AA seqDB search
MPKREELKRVMVIGSGPIIIGQAAEFDYSGSQACRALKDEGVEVILVNSNPATIMTDQNI
ADRVYIEPLTAEVVAKIIKQEKPDGLLPTLGGQTGLNIASELARKGLLEELDIEMLGTPL
DTIEKAEDRDKFIQMLHEIDEPVLESKIADSIEEAKEIAEGIGYPVIIRPAYTMGGTGGG
VADNPEELEEVASRGLKHSLIDEVLIEKSIKGWKEVEYEVMRDGANNCITVCNMENFDPV
GIHTGDSIVVAPSQTLSDKEYQMLRSSSLKIIRELGIEGGCNVQFALDPDSFQYYIIEVN
PRVSRSSALASKATGYPIAKVSTKIALGMTLAEIENAITKKTSACFEPALDYIVFKIPRW
PFDKFHYADRELGTQMKATGEVMAIDRLFESSMLKAVRSLEIGTYSLRLEESSEWTDEEM
KEDLINAEDKRLFVVAEALRRGWSVDEVHEITEIDTFFLWKMQNIIDHEQKIEEADELTA
ELLKEVKKLGFSDKDIAQLRGVTEDKIRELREEKDIDAVYKMVDTCAAEFKAETPYYYSS
YERENESETTDKKKAMVIGSGPIRIGQGIEFDYCSVHSAWALHEEGYESIIANNNPETVS
TDFDTSDRLYFEPLTKEDMLNIIEHEDPEGVVVQFGGQTSINLAKPLADEGVEILGTSVE
AIDIAEDRDKFMNLLDELDIPTPTGSTVYSVPEAKKTATEIGYPVVVRPSYVLGGRAMEV
VYKEEELMQYMETEAKVSEEHPLLVDKYITGKEIEIDAISDGEDVLIPGIMEHIERAGVH
SGDSIAVYPEQTLSEDEREQLIDYTVKLGRALNVKGLINIQYVVADGTVYVIEVNPRSSR
TIPYLSKVTGVPMVKVATKAMLGHKLNDLGYENGLWPEQDHVAVKVPVFSFSKLMKVDTS
LGPEMKSTGEVLGIDHDYAKALYKAFVAAGIDIPEDGTILATIADKDKKEAIPFIKRFAQ
LGFNIVATKGTAKALKETGVEAESVNKISEGSPHVVDLIRDNEIDLVVNTLTKGKEPERD
GFKIRRNAVEYGLPCLTSLDTTEAILHVLEEIKTEGNDNFEYLALQDYMA
NT seq 3213 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaacgggaagagcttaagcgagtaatggtcattggatcaggaccgattattatt
ggacaggcagcagagtttgattattcaggcagtcaggcctgtcgtgctctgaaggatgaa
ggagtagaggtaattctagttaatagtaatccggctacaattatgacagatcaaaatatt
gctgaccgcgtttatatcgaaccattgactgcggaagtagtagccaagataattaaacag
gaaaagcctgacggtttactgccgactttaggcggccagacaggacttaatattgcttcg
gagttagctcgaaagggtctattagaggaattagatatcgaaatgttgggtactccgctg
gatacaattgagaaggcggaggatagagataagttcattcagatgctgcatgagattgat
gaaccggtattggagagtaagattgctgatagtatagaagaagccaaagagattgccgag
gggatcggctatccagtaattattagaccggcctatactatgggcggtaccggcggcggt
gtagctgataatcctgaggagttagaagaagtagcttcacggggtttaaaacacagttta
atcgatgaagttttgatcgaaaagagtatcaaaggttggaaagaggtagaatatgaggta
atgcgtgatggggctaataactgtattactgtctgtaatatggaaaactttgatccggta
gggatccataccggcgacagtattgtagtggctcccagccagacattatcggataaagag
tatcagatgctcaggtcttcatcactgaagataattagagagttagggattgaaggcggc
tgtaatgtgcagtttgctttagatccagacagcttccagtattatatcatcgaggttaat
ccgcgggttagccgctccagtgccttagcttcgaaggcaacaggatatccaattgctaag
gtatcgactaagattgcactgggtatgactttggcggaaatcgagaatgctattactaag
aagactagtgcctgctttgaaccggcattggattatatcgtctttaagataccgcgttgg
cctttcgataagttccattatgctgaccgggagttaggaactcagatgaaggcaactggt
gaggtaatggctatagaccggctctttgaatcatcaatgcttaaagcggtacgttcatta
gagatcgggacttacagtctgcggctagaagagagttcagagtggactgatgaagagatg
aaagaggacttaatcaatgccgaggataaacggctttttgtagtagctgaggctctacgc
cgcggctggtcagtggatgaggtgcatgagattactgagattgataccttcttcctctgg
aagatgcagaatatcatcgaccatgaacaaaagattgaggaagctgatgagttaacagct
gagttattaaaggaagttaagaagttaggcttctctgataaagatattgctcaattgcgc
ggagtaactgaagataaaataagagagttaagagaagagaaagatattgatgctgtctat
aagatggttgatacctgtgcagctgaatttaaagctgagacgccttattactattcttct
tatgaacgggagaatgaatcagagactactgacaagaagaaggctatggttatcggttcg
ggaccgattcggatcggacagggaattgagtttgattactgtagtgttcattcggcctgg
gcgctgcatgaagaaggttatgaatcgattattgccaataataatccagagacagtaagt
accgacttcgatacttctgatcggttatacttcgagccgctgactaaagaggatatgctg
aatattattgaacatgaggatccggaaggagtagtagttcagttcggtgggcagacatca
attaacttagctaaaccactggctgacgaaggagttgaaatattaggaacttcggtagaa
gctattgatattgccgaggaccgggataaattcatgaatcttttggatgaattagatatt
cctactccgacaggaagtactgtctattctgtaccggaggctaaaaagacggcgactgaa
attggttatccggtagtagtgagaccgtcttatgttctaggcggtagagctatggaagtt
gtctataaagaagaagagttaatgcaatatatggaaacggaagctaaggtttctgaggag
catccgctcttagttgataagtatattacgggtaaggaaattgagattgatgctatttct
gatggcgaagatgtcttaattcccggtatcatggagcatatagaacgggccggcgttcac
tctggcgacagtattgctgtctatccggaacagacgttgagtgaagatgaacgtgaacag
ttaattgattatacagttaagttgggccgtgctctcaatgtaaagggtctgattaatatc
cagtatgttgtggctgatggtactgtctatgtaatcgaggttaatccgcgttccagccgg
acaattccgtatctcagtaaggtaactggagtgccgatggttaaagttgctactaaggca
atgttaggccataaattaaacgacttaggctatgagaacggtctttggcctgaacaggat
catgtagcggtaaaggtaccggtcttctccttctctaaattaatgaaggttgatacttcc
ttaggccctgagatgaagtcaacaggtgaggtattgggaatcgaccatgactatgctaag
gctctctataaagcttttgtagcagctggtatcgatattccagaagatggtacaattcta
gctactattgctgataaggataagaaagaagctattccgttcattaagcggtttgcccaa
ttaggcttcaatattgtggctaccaagggcacagctaaggcgctaaaagagactggcgta
gaagctgaatcggttaataagatttccgaaggttcaccacatgtagttgatttgattcgt
gataatgagattgatttagtagttaatactttaaccaaggggaaggaaccggagagggac
ggctttaagattagaagaaatgctgtagaatacggcctaccctgcctgacatcgctggat
actacggaggctatcctgcatgtgttggaagagattaagactgaaggaaatgataatttt
gaatatctggccttgcaggattatatggcctaa

DBGET integrated database retrieval system