KEGG   Acetohalobium arabaticum: Acear_0930Help
Entry
Acear_0930        CDS       T01290                                 

Definition
dihydropteroate synthase DHPS
Organism
aar  Acetohalobium arabaticum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1004033..1004830
Genome map
AA seq 265 aa AA seqDB search
MIIIGELINTSRDEVEPAVKDRDTEFIQELAKKQEEAGADYIDVNCGTLIKEEPEALEWL
VETVQEVVDVPLCIDSPDPEAIKRGLEAHEGKALVNSITAEEDRFQEILPLIQEYDAQII
ALVMNEEGMPEDDTDRIETATKLIEDLTAEGIAEDDIYVDPIIQPIGTDEEMGEYILSAI
DEITNKYQEVHITCGLSNISHGLPQRKLLNQTFVVLAMSRGMDSAILDPLDEKIMSLATA
ADTLLGKDQYCSNYIKASKSDKLTV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgataattattggagaattaatcaatacgagtcgtgatgaagtagaacctgcagttaag
gatagagatactgagtttattcaagagttggctaaaaagcaggaagaagccggagctgac
tatatcgatgttaattgcggaaccttaattaaggaagagccagaagcactagagtggtta
gttgaaacagtacaggaagttgtagatgtaccattatgtatcgatagtcctgatccagaa
gcaattaaaagaggcctagaggctcatgagggcaaagccttagtcaattcaattactgcc
gaagaagatagattccaagagattctaccattaattcaggaatatgatgctcaaattata
gccttagtgatgaatgaggaaggtatgcctgaagatgatacggatagaattgaaacagca
actaagctaattgaggatctaactgctgagggtattgccgaagatgatatctatgttgat
ccaattattcagccgatcggaactgatgaggagatgggagaatatattctatctgctatt
gatgagattactaacaaatatcaagaagtacatattacttgtgggctaagcaatatctct
cacggtctgccgcagagaaagcttttaaatcagactttcgtagtactagcaatgagtaga
ggtatggatagtgctattttggatcccttggacgaaaagattatgtctctggctacggcg
gctgatactttattagggaaggatcagtactgtagtaattacattaaagcatccaagagt
gataaattaactgtttaa

DBGET integrated database retrieval system