KEGG   Acetohalobium arabaticum: Acear_1104Help
Entry
Acear_1104        CDS       T01290                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00260  Glycine, serine and threonine metabolism
aar00750  Vitamin B6 metabolism
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
aar01120  Microbial metabolism in diverse environments
aar01230  Biosynthesis of amino acids
Module
aar_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acear_1104
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Acear_1104
Enzymes [BR:aar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Acear_1104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP Herpes_ORF11 Longin DUF1542
Motif
Other DBs
NCBI-ProteinID: ADL12627
UniProt: D9QQ36
Position
1189325..1190818
Genome map
AA seq 497 aa AA seqDB search
MKYISTRGNYDKVDASEAIRLGMVPTGGLFVPEEIPTLSRETINSMQNSSYQEIVEKILD
EFLTDYTEQELQEAVAKAYNCDNFSVEEITSLYKLDDNSHVLELWHGPTAAFKDLALQVM
PYLLSQAIEKEETDKDILILVATSGDTGKAALEGFKNVDGIEIIVFYPEEGVSQVQKRQM
VTTTGDNTAVVAVAGNFDDCQSSVKEIFGDQNFKEVIADKGYQLSSANSINWGRLVPQII
YYFAAYAELLNQKEIKPGEEINITVPTGNFGNILASYYAYRMGLPVNKFICASNDNKVLT
DFFKTGVYDKNRDFKKTVSPSMDILISSNLERFLFEVTGHDAQKVTNWYQQLKEEGKFEV
DEETKDRINEIFVGEYATEDETKETIQAVYQEHNYVIDPHTAVGVNVYNKYFNNYNDKTT
TVIDATANPYKFGTTVLSAINDSVITDEMTEFDILEELNEETGVEIHSGLEGLANQEIKH
ELKCKVDGIRDIIQQVL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatatcagtactagaggtaattatgataaggtagatgcttcggaagcgataagg
ttaggaatggtacctactggaggtttatttgtccccgaagagatacctacattaagtaga
gagacaattaattctatgcagaatagttcgtatcaggagattgtagagaagattttggat
gagtttttgactgattatacagagcaagaattacaggaagcagttgctaaggcctacaat
tgtgataacttttctgttgaagagataacttcgctatataaattagatgataacagccat
gttcttgaattatggcatggtccaacagcagcatttaaggatttagcattacaggttatg
ccttatttattaagccaggctatagaaaaggaagagacggataaggatattctaatttta
gtagctacttctggtgatacaggtaaggctgctctggaaggttttaagaatgtggatgga
attgagattattgttttctatcctgaagagggagtaagtcaagttcaaaagagacagatg
gtaactaccacaggagataatactgctgtggtagcagtagccggtaattttgatgactgt
cagagtagtgttaaagagatttttggagaccaaaacttcaaagaagttattgctgacaaa
ggatatcagctttcttcggctaattcaattaattggggtaggttagtgccgcagattatc
tattactttgctgcttatgctgaattacttaatcaaaaagagattaaaccgggagaagag
attaatattactgtgcctaccggtaactttggaaatattttagccagttattatgcttat
cgaatgggattgccggttaataaattcatttgtgcttctaatgataataaggtattgact
gatttctttaaaacaggtgtttatgataaaaatcgcgactttaagaaaacagttagtcct
tctatggatattcttatctcttctaatttagaacggttcttatttgaagtgaccggtcat
gatgcccagaaggtaactaactggtatcaacagttaaaagaggaaggaaagtttgaagta
gatgaagagacaaaagatagaattaatgaaatctttgttggtgagtatgctactgaagat
gagactaaggaaactattcaagctgtctatcaggagcataattatgtaatagatcctcat
actgcagtaggagttaatgtatataataagtattttaataactataacgataaaacaaca
acggtaattgatgctacagccaatccatataaatttgggactaccgttttaagtgccatc
aatgattctgtaattacggatgaaatgactgaatttgatattttagaggaattaaatgag
gaaactggagttgaaattcattctggtttagagggattagctaatcaagaaattaaacat
gaacttaaatgtaaagtagatggaattagagatattattcaacaggttctgtaa

DBGET integrated database retrieval system