KEGG   Acetohalobium arabaticum: Acear_1293Help
Entry
Acear_1293        CDS       T01290                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aar  Acetohalobium arabaticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acear_1293
Enzymes [BR:aar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Acear_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1375713..1376699)
Genome map
AA seq 328 aa AA seqDB search
MKEIIKRLTEAYGPSGHEEEIRNLIRSELEDEVDEIRVDKLGNLITYKEGSSDKKVMLAA
HMDEIGLIVTHIDEDGFIRFSNVGGVSPYILLGERVIFGNGLEGVISKEELDSIKKLRFS
KMYIDVGLDSKEDVKEEINIGDVATYKREFSDLGDRLLAKSLDNRAGCALLIETIKNLST
LANDTYFVFTVQEEVGIRGAQTSAFGINPDLGIAVDVTGTGDTPESRRMAVSLGEGPAIK
VKDRSVITHPKVKDLMVSTAEEQEISYQLEVLEFGGTDAGSIHLTRKGVPTGVLSIPARY
IHTPSEVVDYSDVENGVKLLDSILQKEV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagagataattaaacgtctaacagaagcttatggaccttccggtcatgaagaagag
ataagaaacttaattagatctgagcttgaagatgaagtggatgagattagagtagataag
ttgggaaatttaattacttataaggaaggaagcagtgataaaaaggtaatgctggccgcc
catatggatgagataggcttgatagttacccatattgatgaagatggattcattagattt
tctaatgtcggcggtgtttcgccttatatcttattgggagagagggtgatttttggaaat
ggtttagaaggagttattagtaaagaggagttagatagcattaaaaaattaaggttcagc
aagatgtatattgatgtagggttagatagtaaagaggacgtaaaagaagaaattaatatc
ggtgatgtggctacctataaacgtgaattttctgatttaggcgataggttgcttgctaaa
tcgctggataatagagccggctgtgctcttttaattgaaactattaagaatctctcgact
ttagctaatgatacttattttgtttttactgttcaagaagaagtgggaattagaggagcc
cagacttcagcttttggaatcaatcctgacttagggattgcagttgatgtaaccggcact
ggtgatacaccagagtcaagaagaatggcggtttcgttaggagaaggaccagcaattaag
gttaaggatagatcggtgattacccatcctaaagttaaagatttaatggtatcgacggct
gaagaacaagagatttcttatcagttggaggttttggagtttggtggtactgatgccggt
agtattcatctaacacgtaagggagtaccgactggagtcttatccattccggctcgttat
attcatactccaagcgaagtagtggattatagtgatgtagagaatggcgtcaagttgctg
gatagtattctacagaaagaggtttag

DBGET integrated database retrieval system