KEGG   Acetohalobium arabaticum: Acear_1294Help
Entry
Acear_1294        CDS       T01290                                 

Definition
peptidase M42 family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
aar  Acetohalobium arabaticum
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Acear_1294
Enzymes [BR:aar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Acear_1294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1376683..1377720)
Genome map
AA seq 345 aa AA seqDB search
MLLGKLSEAVGISGAEDEVRDLIKEEVADYVDEVKTDALGNLITYKEGNPSLPTLLVAAH
MDEIGLMITNIEKNGLLSFKPVGAVDKRILVSKQVVIGDDKVPGVIGAKAIHLQKPAERR
KPLRIKQLYIDIGAKDEQAAKKLVQIGDTATFSTKFSQLNDKTVKGKAFDDRVGCSLLIK
LLKQNYNFPVYGIFSVQEEVGLRGAGPAVYDLEPDLALVLEGTTASDVPESKEHAYSTTV
GEGPALTIMDATIIPNRSLLQEIITVAEKEEIDYQFRKSTAAGTDAGRVHLSKEGIPTAV
ISVPVRYIHSPASMLNLDDYQTTHDLVDKFSVKLAQGGISLERDN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcttttaggtaagttatctgaggcagtaggaatttcaggggcagaagatgaagtaaga
gatcttattaaagaagaagtagccgattatgttgatgaagtcaagactgatgcgttgggc
aatttgattacttataaagaaggtaatccgtctttaccaacattactggtagcggcccat
atggatgaaattggtttaatgattacaaatatagaaaagaatggtcttttaagcttcaaa
ccagtaggggctgtcgataaaagaattctggtttcaaaacaggtagtaatcggtgatgat
aaagttccaggcgtgattggtgctaaagcaattcatttacagaagcctgctgaacgcaga
aaaccgcttcggattaagcagctatatattgatattggggctaaggatgaacaggctgct
aagaagttggtccagataggtgatactgctacttttagtacgaagttttctcagttaaat
gacaagacagtaaaaggaaaagcctttgatgaccgagtcggctgttcattattaattaag
ttactcaagcagaattataattttcctgtttatggtatcttttctgtacaggaggaagtt
ggacttagaggagcaggtccggctgtctatgatcttgaacctgatttagctttagtttta
gaggggactactgcctctgatgtgccggaaagtaaggaacatgcctactctactacagtt
ggagaaggacctgcgttaactataatggatgctacaataattcctaaccgcagtctgctg
caggagattattactgtagctgaaaaagaggaaatagattatcagttcagaaagtctaca
gctgcgggaactgatgccggccgggttcatctctcaaaagaaggaattccaacggcagtt
atctctgttccggtacgctatatacattcgcctgcttctatgttaaatctggatgattat
caaacgactcacgatttagttgataaattttctgtaaaattagcccaaggaggtattagt
cttgaaagagataattaa

DBGET integrated database retrieval system