KEGG   Acetohalobium arabaticum: Acear_1295Help
Entry
Acear_1295        CDS       T01290                                 

Definition
(GenBank) peptidase M42 family protein
Organism
aar  Acetohalobium arabaticum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1377711..1378769)
Genome map
AA seq 352 aa AA seqDB search
MENRDFLEKLSGYTGVSGREEKVAEIIRGSFSDYTDEIKTDTLGNLIALKEGEDKRKDKL
QIMLAAHMDEIGLMVKDIDDDGFIKFTTVGGIDQRTLVGQEVTIYGKKAIKGIIGAKPPH
VQEKEERNKAVKIEDMYIDVGRDNKEVTDLVSVGDLAVIERRFSELDGNRVSGKALDDRS
GVTVILECLKELQRLHHTADVYPTATVQEEVGVRGATTSTYGIVPDIGIVIDVGHGKMPG
TSEEDTAKLGDGPVIVLGPQIHPKLHKKLKEIANEYEIPYQINAETTPRGTDAFAVQVTR
SGIPTALISIPLRYMHTSVETLDLTDIKQAGRLLANFINQVDAEFVEGLRCF
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaatagagattttcttgagaaattatccggttatactggagtttcaggtagagaa
gaaaaagttgcagaaattataagagggagcttcagtgattatactgatgaaatcaagact
gatacattaggtaatttaattgctttaaaagaaggagaagataaaagaaaagataagctc
cagattatgttggctgctcatatggatgaaattggtttaatggttaaagatatagatgat
gatggatttattaagtttactactgtaggtggaattgatcagcgaacccttgttggacaa
gaggtaactatatatggtaagaaggctattaaggggattattggagctaaaccgcctcat
gttcaggaaaaggaggagagaaataaggcagttaagatagaggatatgtatatagatgta
ggtcgagataataaagaagtaactgacttagtttctgttggagacttagcagtgattgaa
cgtcggtttagtgagttagatggtaacagagttagcggtaaagcattggatgatagatca
ggtgtgacggtaatactggaatgtctaaaggagctgcagcgtttacatcatacagctgat
gtctatccgacggctactgtacaggaagaagtaggagtcagaggagcaactaccagcacc
tacggaattgtacctgatatcggaattgtaatcgatgtcggccatggcaagatgccgggt
acttctgaggaggatacagccaagttaggtgatgggccagtaattgttttaggcccccag
atacatcctaaattgcataaaaagttaaaagagatagctaatgaatatgagattccttat
caaattaatgctgaaactactcctcgcgggacagatgcctttgctgttcaggttacgaga
agcggcattcccactgctttaatttcgattcctcttcgctatatgcatacttcggtagaa
actttggatttaacagatattaaacaggctggtcgcctgttggctaactttattaatcag
gttgacgctgagtttgtggagggattaagatgcttttag

DBGET integrated database retrieval system