KEGG   Acetohalobium arabaticum: Acear_1451Help
Entry
Acear_1451        CDS       T01290                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00230  Purine metabolism
aar01100  Metabolic pathways
Module
aar_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Acear_1451
Enzymes [BR:aar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Acear_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 ABC_tran RsgA_GTPase CPT AAA_16 MMR_HSR1 YtxH AAA_14 Zeta_toxin Rad17 AAA_29
Motif
Other DBs
NCBI-ProteinID: ADL12961
UniProt: D9QR20
Position
complement(1549882..1550460)
Genome map
AA seq 192 aa AA seqDB search
MLKSEEGKLIILSGPSAVGKGTVITALMDEYQDISYSVSVTTRQPRVDEEDGVDYFFVSE
TEFKEMIDNDEFIEWAKVHENYYGTPKKCVEDTLASGQDVILEIDIQGAAQVKKSYQQGV
FIFLAPPSLEELEARIQKRGTDSQKAIEVRMENATEEMERAENYDYIVVNDEVEEAVEKV
KSVIIAERCKVD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtctgaagaaggaaaattaattattctgtctggaccatcagctgtaggtaag
ggcacagtcattacagcactgatggatgaataccaggatatatcttattctgtttcagtt
actacccgccagcctcgtgttgatgaagaggatggggttgattatttcttcgtatcggaa
acagaatttaaggaaatgatcgataatgatgagtttatagaatgggccaaagtacatgag
aattattatggtacgcctaaaaagtgtgttgaagatactctagctagtgggcaggatgtg
attctggagatagatattcagggggctgcccaggtgaagaagagttatcaacagggggtt
tttatctttttagcccctccgtctctggaagaactggaggcaagaattcaaaagcgtggt
actgacagccagaaagcaatagaggttagaatggagaatgctactgaagagatggaacgg
gcagaaaattatgattatatagttgttaatgatgaggttgaggaagcagtagagaaagta
aagtcggttattattgctgaacgctgtaaagtagactaa

DBGET integrated database retrieval system