KEGG   Acetohalobium arabaticum: Acear_1451Help
Entry
Acear_1451        CDS       T01290                                 

Definition
guanylate kinase (EC:2.7.4.8)
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
aar  Acetohalobium arabaticum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Acear_1451
Enzymes [BR:aar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Acear_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1549882..1550460)
Genome map
AA seq 192 aa AA seqDB search
MLKSEEGKLIILSGPSAVGKGTVITALMDEYQDISYSVSVTTRQPRVDEEDGVDYFFVSE
TEFKEMIDNDEFIEWAKVHENYYGTPKKCVEDTLASGQDVILEIDIQGAAQVKKSYQQGV
FIFLAPPSLEELEARIQKRGTDSQKAIEVRMENATEEMERAENYDYIVVNDEVEEAVEKV
KSVIIAERCKVD
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagtctgaagaaggaaaattaattattctgtctggaccatcagctgtaggtaag
ggcacagtcattacagcactgatggatgaataccaggatatatcttattctgtttcagtt
actacccgccagcctcgtgttgatgaagaggatggggttgattatttcttcgtatcggaa
acagaatttaaggaaatgatcgataatgatgagtttatagaatgggccaaagtacatgag
aattattatggtacgcctaaaaagtgtgttgaagatactctagctagtgggcaggatgtg
attctggagatagatattcagggggctgcccaggtgaagaagagttatcaacagggggtt
tttatctttttagcccctccgtctctggaagaactggaggcaagaattcaaaagcgtggt
actgacagccagaaagcaatagaggttagaatggagaatgctactgaagagatggaacgg
gcagaaaattatgattatatagttgttaatgatgaggttgaggaagcagtagagaaagta
aagtcggttattattgctgaacgctgtaaagtagactaa

DBGET integrated database retrieval system