KEGG   Acetohalobium arabaticum: Acear_1688Help
Entry
Acear_1688        CDS       T01290                                 

Definition
(RefSeq) diaminopimelate decarboxylase (EC:4.1.1.20)
  KO
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
aar  Acetohalobium arabaticum
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acear_1688
  Amino acid metabolism
   00300 Lysine biosynthesis
    Acear_1688
Enzymes [BR:aar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.20  diaminopimelate decarboxylase
     Acear_1688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1783060..1784373)
Genome map
AA seq 437 aa AA seqDB search
MVLHGTMEVNEKGNLEVGGCDVTNIATEYGTPLYILDEEELRDNCRAYRQAFEEWYPNSE
TIYASKAFMSLTICKIVEEEGLGLDVVSGGELYTALEADFPTDKIYFHGNNKTPEELEMV
LNEEIGRIVVDNNYELELLNELADQQGKRADILIRVTPGVEAHTHSYIQTGQTDSKFGVG
IQNGLALETVKKAVELENIDVKGIHCHIGSQIFNLESFEVAVDVMLDFVEEVKIETGLVM
EELNIGGGIGIKYTDKDQSVSIDQYAELVAKAIKQKCEEINIPLPKIINEPGRSIIGTAG
STIYTVGSIKNIPDVRKYVAVDGGMPDNIRPALYEAEYEAIVANKANRKPEEVVSITGKC
CESGDMLIWDIELPEMEPGDVLLTPCTGAYGYAMANNYNSLPKPGVVLINNGQVEEIIRG
ERYEDLVAKEEIPARLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtattacatggaacaatggaagtaaatgaaaaaggaaatttagaagttggaggatgt
gatgtaactaacatagctacagaatatgggacgccgctatatattcttgatgaagaggag
cttagagataactgtcgggcatatcgccaggcttttgaagaatggtatcccaactcagaa
actatttatgctagtaaggcttttatgtcgcttacaatctgtaaaattgttgaagaagaa
ggattaggtttagatgttgtatcaggcggtgaattatatactgctttggaagcagacttt
ccgacagataagatctactttcacggcaataataagactcctgaggagttagagatggtc
ttaaatgaagaaataggtcgaatcgtagtcgataataattatgaactggaactgttgaat
gaattagcagaccagcagggaaaaagagcagatatattaattagagttactccgggtgtt
gaggcccatactcatagttatatccaaacaggccagacggattccaagttcggagttggt
attcagaatggattggccttagaaacagttaagaaggctgttgaattagaaaatatagat
gtcaagggaattcactgccatattggttcccagatctttaatctggagtcttttgaggta
gcagttgatgtaatgcttgattttgtagaagaagttaagatcgaaaccggattagtaatg
gaagaattgaatataggcggcggtattggaattaagtatactgataaggatcaatcagta
agtattgatcagtatgctgagttagtagctaaagctattaaacagaagtgtgaagagatt
aatattcccctacctaagataatcaacgaaccgggacggtcaattatcggaacagcagga
tcaactatttatacagtaggttccattaagaatattcctgatgttcgaaagtatgtagca
gttgacggcggaatgcctgataatattcggccggctctttatgaagcagagtatgaagcc
attgtagctaataaagccaaccggaagcctgaggaagtagtttcgattaccggtaaatgt
tgcgaatcaggagatatgttaatctgggatattgaattgcctgaaatggagccgggagat
gttctattaactccttgtaccggtgcctacggctatgcaatggccaataattataatagt
ctacctaaaccgggagtcgtactgattaataacggtcaggtagaggagattatccgggga
gaaagatatgaagatctggtagcaaaagaagagattcctgctcgattaaagtaa

DBGET integrated database retrieval system