KEGG   Acetohalobium arabaticum: Acear_1688Help
Entry
Acear_1688        CDS       T01290                                 

Definition
diaminopimelate decarboxylase (EC:4.1.1.20)
Orthology
K01586  
diaminopimelate decarboxylase [EC:4.1.1.20]
Organism
aar  Acetohalobium arabaticum
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, DAP aminotransferase pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aar01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:aar00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1783060..1784373)
Genome map
AA seq 437 aa AA seqDB search
MVLHGTMEVNEKGNLEVGGCDVTNIATEYGTPLYILDEEELRDNCRAYRQAFEEWYPNSE
TIYASKAFMSLTICKIVEEEGLGLDVVSGGELYTALEADFPTDKIYFHGNNKTPEELEMV
LNEEIGRIVVDNNYELELLNELADQQGKRADILIRVTPGVEAHTHSYIQTGQTDSKFGVG
IQNGLALETVKKAVELENIDVKGIHCHIGSQIFNLESFEVAVDVMLDFVEEVKIETGLVM
EELNIGGGIGIKYTDKDQSVSIDQYAELVAKAIKQKCEEINIPLPKIINEPGRSIIGTAG
STIYTVGSIKNIPDVRKYVAVDGGMPDNIRPALYEAEYEAIVANKANRKPEEVVSITGKC
CESGDMLIWDIELPEMEPGDVLLTPCTGAYGYAMANNYNSLPKPGVVLINNGQVEEIIRG
ERYEDLVAKEEIPARLK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggtattacatggaacaatggaagtaaatgaaaaaggaaatttagaagttggaggatgt
gatgtaactaacatagctacagaatatgggacgccgctatatattcttgatgaagaggag
cttagagataactgtcgggcatatcgccaggcttttgaagaatggtatcccaactcagaa
actatttatgctagtaaggcttttatgtcgcttacaatctgtaaaattgttgaagaagaa
ggattaggtttagatgttgtatcaggcggtgaattatatactgctttggaagcagacttt
ccgacagataagatctactttcacggcaataataagactcctgaggagttagagatggtc
ttaaatgaagaaataggtcgaatcgtagtcgataataattatgaactggaactgttgaat
gaattagcagaccagcagggaaaaagagcagatatattaattagagttactccgggtgtt
gaggcccatactcatagttatatccaaacaggccagacggattccaagttcggagttggt
attcagaatggattggccttagaaacagttaagaaggctgttgaattagaaaatatagat
gtcaagggaattcactgccatattggttcccagatctttaatctggagtcttttgaggta
gcagttgatgtaatgcttgattttgtagaagaagttaagatcgaaaccggattagtaatg
gaagaattgaatataggcggcggtattggaattaagtatactgataaggatcaatcagta
agtattgatcagtatgctgagttagtagctaaagctattaaacagaagtgtgaagagatt
aatattcccctacctaagataatcaacgaaccgggacggtcaattatcggaacagcagga
tcaactatttatacagtaggttccattaagaatattcctgatgttcgaaagtatgtagca
gttgacggcggaatgcctgataatattcggccggctctttatgaagcagagtatgaagcc
attgtagctaataaagccaaccggaagcctgaggaagtagtttcgattaccggtaaatgt
tgcgaatcaggagatatgttaatctgggatattgaattgcctgaaatggagccgggagat
gttctattaactccttgtaccggtgcctacggctatgcaatggccaataattataatagt
ctacctaaaccgggagtcgtactgattaataacggtcaggtagaggagattatccgggga
gaaagatatgaagatctggtagcaaaagaagagattcctgctcgattaaagtaa

DBGET integrated database retrieval system