KEGG   Acetohalobium arabaticum: Acear_1839Help
Entry
Acear_1839        CDS       T01290                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
aar  Acetohalobium arabaticum
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Carbon fixation pathways in prokaryotes
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acear_1839
   00630 Glyoxylate and dicarboxylate metabolism
    Acear_1839
   00640 Propanoate metabolism
    Acear_1839
   00650 Butanoate metabolism
    Acear_1839
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Acear_1839
  Lipid metabolism
   00071 Fatty acid degradation
    Acear_1839
   00072 Synthesis and degradation of ketone bodies
    Acear_1839
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Acear_1839
   00310 Lysine degradation
    Acear_1839
   00380 Tryptophan metabolism
    Acear_1839
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Acear_1839
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Acear_1839
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Acear_1839
Enzymes [BR:aar01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Acear_1839
Exosome [BR:aar04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acear_1839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1927279..1928457)
Genome map
AA seq 392 aa AA seqDB search
MEEIVIASAVRTAIGSFGGSLKKVSAIELGTTTIKAALERAELDAGEVDEVIMGNVLQAG
SGQNPARQASVNAGLPVETPAMTINKVCGSGLKAVNLAAQAIKAGDGDVFVVGGMENMSQ
APYVQNKARWGERMGHGKLVDTMIQDGLWCAFNDYHMGITAENVAEQWDISREEQDEFAA
TSQQRAEAALEEGKFEDEIVPVEVPQRKGDPVVFDKDEYPRSGVTAEGLANLRPAFKKDG
TVTAGNASGINDGAAALVVMTKSKAEELGVEPLATIKSYASAGVDPAIMGTGPIPSSKKA
LQEADLTVEDMDLVEANEAFASQSLAVVQDLGLDTEKVNVNGGAIALGHPIGASGARILI
TLLHEMKKQDSKYGLATLCIGGGQGAATVVER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaattgtaattgcaagtgcagtgagaacagcaattggcagttttggtggaagt
ttaaagaaggtttctgctattgagttgggaacaactacaattaaagcagctttagaaaga
gctgaattagatgctggtgaagtagatgaagtaattatggggaatgtcttacaggctggt
tcaggccagaacccggctcgtcaggcatcagttaatgccggcttacctgtggagacaccg
gctatgactatcaataaagtctgtggttcaggtctaaaggcagttaatttagctgcccag
gcaattaaagccggagatggagatgtatttgttgttggcggtatggagaatatgagccag
gcgccttatgttcagaataaagcccgctggggagagagaatgggccacggcaaattagta
gatacaatgattcaagacggcctttggtgtgcattcaatgattatcatatgggtattact
gctgaaaatgtagctgaacagtgggatattagtcgtgaggaacaggatgagtttgctgca
accagtcagcagagagctgaagcggcattagaggaaggtaaattcgaagatgagatagta
cctgtagaagtaccgcagcgaaaaggagacccagttgtattcgataaagatgaatatccc
cgcagtggagtaacagctgaaggattggctaacttacgtccggcctttaagaaggatgga
acagtaactgccggtaatgcatcaggaatcaatgacggagcagctgcattagtggtaatg
actaagagtaaagctgaggaattaggagtagagccactggctactattaagagttatgct
tcagcaggagtagatccagctattatgggaaccggcccgattccttcttctaagaaggca
ttacaggaggcggacttaacagtagaagatatggacttagtagaagccaatgaagctttt
gcatcccagtctcttgcagtagttcaagatttaggattggatactgaaaaggtaaatgta
aatggaggagcaattgctttaggccatccgattggtgctagtggagcaaggatcttaatt
actctgttacatgagatgaagaagcaggactctaagtatggactagccactctttgtatc
ggcggtggacagggagctgctacagtagtagaaagataa

DBGET integrated database retrieval system