KEGG   Acetohalobium arabaticum: Acear_1861Help
Entry
Acear_1861        CDS       T01290                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00010  Glycolysis / Gluconeogenesis
aar00030  Pentose phosphate pathway
aar00051  Fructose and mannose metabolism
aar00052  Galactose metabolism
aar00680  Methane metabolism
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
aar01120  Microbial metabolism in diverse environments
aar01130  Biosynthesis of antibiotics
aar01200  Carbon metabolism
aar01230  Biosynthesis of amino acids
aar03018  RNA degradation
Module
aar_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_1861
   00030 Pentose phosphate pathway
    Acear_1861
   00051 Fructose and mannose metabolism
    Acear_1861
   00052 Galactose metabolism
    Acear_1861
  Energy metabolism
   00680 Methane metabolism
    Acear_1861
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Acear_1861
Enzymes [BR:aar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Acear_1861
Protein phosphatases and associated proteins [BR:aar01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Acear_1861
Messenger RNA biogenesis [BR:aar03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Acear_1861
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_1 DAGK_cat
Motif
Other DBs
NCBI-ProteinID: ADL13364
UniProt: D9QS73
Position
complement(1958498..1959496)
Genome map
AA seq 332 aa AA seqDB search
MDKIGVLTSGGDAPGMNAAVRAVTRKAIYEGLEIIGIKRGYTGVIESDFMVMDRGSVADI
IHRGGTMLHSARCEEFRTEAGRKKAIEQLKYGGIEGLIVIGGDGSFKGAQLLSEESDIKV
VGVPATIDNDIACTDYSIGYDTAMNTILDAINKIRDTATSHERTFVVETMGRHSGILTLM
SGLAGGAESILVPEIDFSLEEVCEKLNHGYERGKLHSIILVAEGIEQDFTSSTDNNESQA
FAIAEEISNRTGFETRVTVLGHLQRGGIPTAQDRILGSRLGAAAVDLLLEGETNKMVGVV
HEEVKSFPIEESLTRSKDLNKEIYKLADILSL
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggataaaattggtgtcttgactagtggtggagatgcaccgggtatgaatgctgctgtt
agggcagtaaccagaaaggctatctatgagggattagaaataatcggcattaaacgcggt
tatactggtgttatcgaaagtgattttatggtaatggaccgcggttctgtagctgatatt
atccatcggggcgggactatgctacattctgctcgctgtgaagaattcagaactgaagca
ggacgtaaaaaagctattgaacagctaaaatacggcggaattgaaggattgatagtgatc
ggcggtgatggttcttttaagggagctcagttactcagtgaggaatcggatattaaggta
gttggagttcctgccactatagataatgatattgcctgtactgattattctattggttat
gatacagcaatgaatactattttagatgctattaataagattagagatacggctacttct
catgaacggacctttgtagtggaaactatggggcggcattctggaatcttaaccttgatg
tctggattagctggtggagcagaatcaattctagtaccggagatagattttagccttgaa
gaagtctgtgaaaagttaaaccatggttatgagcgcggtaaactgcatagtattatttta
gtagcggaagggattgaacaggattttacctcttcaactgataataatgaaagccaggcc
tttgctatagcagaagaaatcagtaatagaaccggttttgagacgagagttactgtcttg
ggccatctgcagcgcggcgggattcccacagctcaggataggattttaggcagccgctta
ggtgcagcagctgttgatcttttattagaaggagaaactaataaaatggtaggcgttgtt
catgaagaggttaaaagctttccaatcgaagagtctttaaccagatctaaggatttaaat
aaagaaatctataaattagcagatatcttatcattataa

DBGET integrated database retrieval system