KEGG   Acetohalobium arabaticum: Acear_1865Help
Entry
Acear_1865        CDS       T01290                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00260  Glycine, serine and threonine metabolism
aar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
aar01130  Biosynthesis of antibiotics
aar01230  Biosynthesis of amino acids
Module
aar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acear_1865
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acear_1865
Enzymes [BR:aar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acear_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth UxuA
Motif
Other DBs
NCBI-ProteinID: ADL13368
UniProt: D9QS77
Position
complement(1963236..1964033)
Genome map
AA seq 265 aa AA seqDB search
MNRIEEKFKQLKKQEETALMPYITAGDPTLGFTKKLIKEFEASGVDMIELGVPYSDPLAD
GPTIQQAAQRALSAGADLEQIFGLIEEVRTEVEIPIILMGYYNSFYKYSLQEVVSKAEEV
GVDGLIIPDLPPEEAEEVEKFKNGDQLSSIFLLAPTSSEERMELVNQQSDGFIYCVSTLG
VTGARNKLSSQLQGFLARVRQHSDQPLAVGFGISAPKQAAQVAKYAEGVIVGSAIIDRIA
ENLDQREEVMLKEVSSLVKRLKKAL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattgaagagaagtttaagcagttaaagaagcaggaagagacggctttaatg
ccctatattactgctggggatccaacattagggtttactaagaaattaattaaagagttt
gaagcttcaggggttgatatgattgagttaggagttccttattctgatccactggccgat
ggaccgacaattcaacaggcagctcagcgagctttatcagccggagctgatcttgagcag
atatttggtttaatcgaagaagtaaggactgaagtggagattccaattattttaatgggt
tattataactctttttataagtacagtctgcaggaagtagtttctaaagcagaagaagta
ggagtagacggcttaattattcctgacctgccgcctgaggaagctgaggaagtagagaag
tttaaaaacggtgatcaattaagcagtatattcttattggcaccgactagttctgaagaa
cggatggaattagttaaccagcagagcgacggatttatctactgtgtttctactctggga
gtaacaggagctagaaataaattatcatctcagctgcagggttttttagctagagtaaga
cagcatagtgatcagccgctagcagtaggattcggtatttctgctcccaagcaggcagcc
caggtagctaaatatgccgaaggagttattgtcggtagcgctattatagatagaatagct
gaaaacttagatcagagggaagaggtaatgttaaaagaagtaagtagtttggttaaaaga
ttaaagaaggctctttag

DBGET integrated database retrieval system