KEGG   Acetohalobium arabaticum: Acear_1865Help
Entry
Acear_1865        CDS       T01290                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aar  Acetohalobium arabaticum
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acear_1865
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acear_1865
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acear_1865
Enzymes [BR:aar01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acear_1865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1963236..1964033)
Genome map
AA seq 265 aa AA seqDB search
MNRIEEKFKQLKKQEETALMPYITAGDPTLGFTKKLIKEFEASGVDMIELGVPYSDPLAD
GPTIQQAAQRALSAGADLEQIFGLIEEVRTEVEIPIILMGYYNSFYKYSLQEVVSKAEEV
GVDGLIIPDLPPEEAEEVEKFKNGDQLSSIFLLAPTSSEERMELVNQQSDGFIYCVSTLG
VTGARNKLSSQLQGFLARVRQHSDQPLAVGFGISAPKQAAQVAKYAEGVIVGSAIIDRIA
ENLDQREEVMLKEVSSLVKRLKKAL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattgaagagaagtttaagcagttaaagaagcaggaagagacggctttaatg
ccctatattactgctggggatccaacattagggtttactaagaaattaattaaagagttt
gaagcttcaggggttgatatgattgagttaggagttccttattctgatccactggccgat
ggaccgacaattcaacaggcagctcagcgagctttatcagccggagctgatcttgagcag
atatttggtttaatcgaagaagtaaggactgaagtggagattccaattattttaatgggt
tattataactctttttataagtacagtctgcaggaagtagtttctaaagcagaagaagta
ggagtagacggcttaattattcctgacctgccgcctgaggaagctgaggaagtagagaag
tttaaaaacggtgatcaattaagcagtatattcttattggcaccgactagttctgaagaa
cggatggaattagttaaccagcagagcgacggatttatctactgtgtttctactctggga
gtaacaggagctagaaataaattatcatctcagctgcagggttttttagctagagtaaga
cagcatagtgatcagccgctagcagtaggattcggtatttctgctcccaagcaggcagcc
caggtagctaaatatgccgaaggagttattgtcggtagcgctattatagatagaatagct
gaaaacttagatcagagggaagaggtaatgttaaaagaagtaagtagtttggttaaaaga
ttaaagaaggctctttag

DBGET integrated database retrieval system