KEGG   Acetohalobium arabaticum: Acear_1868Help
Entry
Acear_1868        CDS       T01290                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
aar  Acetohalobium arabaticum
Pathway
aar00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aar01100  Metabolic pathways
aar01110  Biosynthesis of secondary metabolites
aar01130  Biosynthesis of antibiotics
aar01230  Biosynthesis of amino acids
Module
aar_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acear_1868
Enzymes [BR:aar01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Acear_1868
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE QRPTase_C FMN_dh His_biosynth ThiG Ribul_P_3_epim Gly_reductase PAD_porph
Motif
Other DBs
NCBI-ProteinID: ADL13371
UniProt: D9QS80
Position
complement(1965822..1966616)
Genome map
AA seq 264 aa AA seqDB search
MFLDKIVANTKEEVKQRKEEISLTELKERLRPVDEVRDFKAALTNSVLGLIAEIKQASPS
KGLIRKDFNPVEIAKKYSQNRVEAISILTDEEFFQGSLEYLQQVREATDLPLLRKDFIID
PYQVYEAQAHGADAVLLIVNILTEKKLIELISLIRKLGMEALVEVHTAGELKTACRAGAE
IVGINNRNLKTFETDIEQTLQLQELLPADKVIVSESGISSKDDIEKLTDTGVDAVLIGEA
LMRSDDLSNRIAELLGRSDGNGSN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgttcctagataaaatagtggccaatactaaagaagaagtaaagcagcgtaaagaagag
ataagcctaacggaattaaaggagagattacgtccagtagatgaagtcagagacttcaaa
gcagccttaactaattcagttttgggattgattgctgaaatcaagcaggcttccccgtca
aaggggttgatcaggaaagactttaatccagtggagatagcaaaaaaatattcccaaaat
agagtggaggctatttcaatattaactgatgaagaattctttcagggcagccttgaatat
ctacagcaggtaagagaagcaacagatctgcccctgctgcggaaggacttcatcattgat
ccttatcaggtttatgaggctcaagcccatggcgccgatgctgtattattgatagtcaat
attctaacggaaaaaaagctgatagaattaatcagtttaattcgaaagctgggaatggaa
gcattagtggaagtccatacagctggggagttaaagacagcctgccgggctggtgctgaa
atagtcggcatcaacaatcggaatctaaagacttttgagactgatatagaacagacgctg
cagctgcaggaattattaccagcagataaagttatagttagcgaaagcggtatctcctct
aaagatgatattgagaaattaactgatactggtgtcgatgctgttttaataggagaagcc
ttaatgcgtagtgatgatctcagcaatagaatagctgaactgctgggtaggagtgatgga
aatggcagcaactag

DBGET integrated database retrieval system