KEGG   Acetohalobium arabaticum: Acear_1963Help
Entry
Acear_1963        CDS       T01290                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
aar  Acetohalobium arabaticum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Acear_1963
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acear_1963
   00620 Pyruvate metabolism
    Acear_1963
   00650 Butanoate metabolism
    Acear_1963
  Lipid metabolism
   00071 Fatty acid degradation
    Acear_1963
  Amino acid metabolism
   00350 Tyrosine metabolism
    Acear_1963
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Acear_1963
   00626 Naphthalene degradation
    Acear_1963
Enzymes [BR:aar01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Acear_1963
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Acear_1963
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2072661..2075258)
Genome map
AA seq 865 aa AA seqDB search
MTQQIVKIPRQPQEQIFTLIDKALEAASQLDVMSQKELDRIIKEMALAGVDNHIRLAELA
VEETEMGVYEDKITKNLFATENVYHDIKDKKTKGVINQDSTTGIIEVAEPVGVIAALIPA
TNPTSTALFKALIALKAGNPVIFSFHPRAFESSKETARIMRNAAIEAGAPEGCIQWIEPS
SEEMTDKLMTHSDVSLVLATGGGSMVQAAYSSGTPAIGVGPGNVPVYIEESADLEQAVHD
ITTSKTFDNGTVCASEQTLLVDKEVSSRVKELFVSYHTYILDEAERKRLEKVAIDSETKA
MNPKVVGQSATKIAEMAGIEVPDDTVLLLVPLQGIGAGYPLSREKLSPILGVQEVADYRE
GIGKISEVVNFDGLGHTAVVHSNCQQVIDEFRTKVKTGRLLVNNPATFGAVGDIYNHLPP
SMTLGCGTFGGNSTTANVTVDQLYNVKRLTDRKVEREWIKLPPEIYFNPGSLSQLSNLEG
EKAVIITDKVMEELGYVQQTAEYLEQAEIDYQVFTGVEPDPSVTTVMEGKEVLEAYGADI
IIALGGGSPIDAAKGMWLFYEYPETDFKDLKLRFMDIKKRVYDFPELGDKAKFVAIPTTS
GSGSEITSFTVITDKENQVKYPLVSYELTPDMAIVDSELAMTLPPKMTAYTGLDVLTHGI
EAYVSVMASDYTDPLALQAIKLVFEYLPRAYKNGTEDKEAREKMHHAACIAGMSFTNAFL
GINHSLAHVLGSKFEISHGLANALLLPHVIKYNAQSPTKFAHYPNYSYHQAGERYNELAK
ELGLKADSREKGVNNLIQEIKNLMITLDLPLSIAELEIDKQEFKSKIGAMAKIAYSDQAT
IANPRKPLVSELEDIYNKAYDGLKA
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacaaatagttaaaatccctcgccaaccacaagaacagatttttactttgata
gataaagctttagaagctgctagccaattggatgtgatgtctcaaaaggagcttgatcgg
ataataaaagagatggccttagcaggtgtagataaccatattcgattagcagagttagca
gtagaagaaacagagatgggagtttacgaagataaaataactaagaatttatttgctaca
gaaaatgtctatcatgacattaaagataaaaaaacaaagggagttatcaatcaggattca
actaccggaattatagaagtagctgaaccagtaggagtaattgcagctttaattccagct
actaatcctacttctactgcgttatttaaggctttaattgctttaaaagcagggaatcct
gttatctttagcttccatccccgggcttttgaatccagtaaggaaacagcccggatcatg
cgtaatgcagctatagaggctggagcaccagaaggctgtattcagtggatagagccttcc
tcagaagagatgactgataaattaatgacacatagtgatgtatcattggtattagccact
gggggcggaagtatggttcaggccgcctatagttcaggaactccggcaattggagtcggc
cctggtaatgtaccagtctatatagaagaatcagctgatttagaacaagcagtacatgat
attacaactagtaaaacatttgataatggtactgtatgtgcttctgagcagactttatta
gtagataaagaggtaagcagtagagtaaaagagttatttgtgagttatcatacctatatt
ctggatgaagctgaaagaaaaagactggagaaagtagcaatagattcagaaactaaggct
atgaatcctaaggttgtaggccaaagtgctactaaaattgctgagatggcagggattgaa
gttccagatgatacagtcttattactagttcctttgcaggggattggagccggctatccc
ttgtcaagagagaagttaagccccattttaggggttcaagaagttgctgattatagagag
gggattgggaagataagtgaagtggttaactttgatggactgggccatactgctgttgtg
cattctaactgccagcaggtgatagatgaattcagaaccaaagtcaaaacaggaagatta
ttagttaataatccagcaacttttggagcggtaggagatatttataaccacttacctccg
tctatgaccttaggctgcgggacttttggtgggaattctactactgctaatgtaactgtt
gatcaactatataatgttaagagattaactgatagaaaagtagaaagagagtggattaaa
ttacctccagagatctattttaatcctggttctttatcccaattaagcaatttagaaggg
gagaaagctgtaataatcactgataaagtcatggaggaattaggttatgttcaacagaca
gcagaatacttagaacaggccgagatagattatcaggtatttaccggagtcgaacctgat
ccttcagtaacaacagtaatggaagggaaagaagttttagaagcttatggggcagatatt
attattgctctaggcggcggttctcctatcgatgctgccaaaggaatgtggttgttctat
gaatatccagagactgattttaaagatttgaagctgaggtttatggatattaagaagcgg
gtttatgattttcctgaattaggggataaagctaaatttgtagctattcctactactagt
ggttcaggttcagaaataacctcctttactgtaattactgataaggagaatcaggtcaaa
tacccattggtttcttatgagttaactcctgatatggcaattgtagattcagagttggcc
atgactctcccccctaagatgacagcctacacaggtttggatgtgttaactcatgggatt
gaagcttatgtatcagtgatggcttctgattatactgatcctttggcattgcaggctatt
aagcttgtttttgaatatctgcctagagcttataagaacgggaccgaagataaagaagct
agagaaaaaatgcatcatgctgcctgtatcgccggaatgtcttttactaatgcttttttg
gggattaatcatagtttagcccatgttttaggtagtaaatttgaaatttcccatggattg
gccaatgctttattattaccacatgtaattaaatataatgctcaatctccgacaaaattc
gctcattatcctaattattcctatcatcaggcaggagaaagatataatgagttggctaag
gaattaggattaaaagcagatagccgagaaaaaggagtgaataatttaattcaagaaatt
aaaaatttaatgataactttagatctaccattgagcattgctgagttagaaattgataaa
caagaatttaaaagtaagattggagccatggccaaaattgcttatagtgatcaagctact
atagccaatccaagaaaacctctagtttcagaactcgaagatatttacaacaaggcctat
gatggacttaaagcttga

DBGET integrated database retrieval system