KEGG   Acetohalobium arabaticum: Acear_2108Help
Entry
Acear_2108        CDS       T01290                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aar  Acetohalobium arabaticum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aar00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:aar00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aar00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aar00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2211463..2212368)
Genome map
AA seq 301 aa AA seqDB search
MQVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVQAGIEDVIIITGRHK
RAIEDHFDKSFELEVNLAEQGKLERLEMVKDISNLVDVHYVRQKEPLGLGHAILCAETFI
GDEPFAVLLGDDIVKSDTPVTKQLIDTFEEKQSTIIGVQKVEDEAVNKYGIVDYSNGNNG
DYKVQDLIEKPSLEEAPSNIAILGRYVITPAIFDILRGTEPGKGGEIQLTDALKTLLDQE
DVYAHIFNGRRYDIGNKLGFLEAVVEFAFARDDIRAPFKDYLLEYLPEELKEEVFNRAAA
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaaaaaagcagttatacctgcggccggattaggtactagattcctgccggca
actaaagcacagccgaaagaaatgctgccgattgttgataagccgacaatccagtacata
gtcgaagaagcagttcaagccggaattgaggatgtaatcatcattaccggccgccataaa
cgagccattgaggaccactttgataaatcctttgagttggaagtaaacttggctgaacag
ggtaagctagaacgcttagagatggttaaagatatctctaatttagttgatgtccattat
gtccgccagaaagaaccgttaggattgggacatgctattttatgtgccgaaacctttatc
ggggatgagccctttgcggttctattaggcgatgatatagtaaagtctgatacgccggtt
accaagcagttgatcgataccttcgaagagaagcagtctacgattatcggcgtccagaag
gttgaggatgaagcagtcaataagtacggtattgttgattattccaacggtaataacgga
gactataaggtacaggacttaattgagaagccttctttagaggaggccccgtccaatatt
gctattttaggccggtatgtgatcactccggctatctttgatatcctacgagggaccgag
ccgggcaaaggcggcgagattcagctgactgatgccttaaagactctgctggatcaggag
gatgtctatgcccatatcttcaatgggcgccgctatgacatcggtaataagttaggcttt
ctagaggcagtagttgagtttgcctttgcgcgggatgatatcagagctcctttcaaagat
tacttactggagtatctacctgaggaattgaaagaagaagtctttaatcgagcagcagct
aaatag

DBGET integrated database retrieval system