KEGG   Acetohalobium arabaticum: Acear_2108Help
Entry
Acear_2108        CDS       T01290                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
aar  Acetohalobium arabaticum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aar00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Acear_2108
   00052 Galactose metabolism
    Acear_2108
   00500 Starch and sucrose metabolism
    Acear_2108
   00520 Amino sugar and nucleotide sugar metabolism
    Acear_2108
Enzymes [BR:aar01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Acear_2108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2211463..2212368)
Genome map
AA seq 301 aa AA seqDB search
MQVKKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAVQAGIEDVIIITGRHK
RAIEDHFDKSFELEVNLAEQGKLERLEMVKDISNLVDVHYVRQKEPLGLGHAILCAETFI
GDEPFAVLLGDDIVKSDTPVTKQLIDTFEEKQSTIIGVQKVEDEAVNKYGIVDYSNGNNG
DYKVQDLIEKPSLEEAPSNIAILGRYVITPAIFDILRGTEPGKGGEIQLTDALKTLLDQE
DVYAHIFNGRRYDIGNKLGFLEAVVEFAFARDDIRAPFKDYLLEYLPEELKEEVFNRAAA
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaaaaaagcagttatacctgcggccggattaggtactagattcctgccggca
actaaagcacagccgaaagaaatgctgccgattgttgataagccgacaatccagtacata
gtcgaagaagcagttcaagccggaattgaggatgtaatcatcattaccggccgccataaa
cgagccattgaggaccactttgataaatcctttgagttggaagtaaacttggctgaacag
ggtaagctagaacgcttagagatggttaaagatatctctaatttagttgatgtccattat
gtccgccagaaagaaccgttaggattgggacatgctattttatgtgccgaaacctttatc
ggggatgagccctttgcggttctattaggcgatgatatagtaaagtctgatacgccggtt
accaagcagttgatcgataccttcgaagagaagcagtctacgattatcggcgtccagaag
gttgaggatgaagcagtcaataagtacggtattgttgattattccaacggtaataacgga
gactataaggtacaggacttaattgagaagccttctttagaggaggccccgtccaatatt
gctattttaggccggtatgtgatcactccggctatctttgatatcctacgagggaccgag
ccgggcaaaggcggcgagattcagctgactgatgccttaaagactctgctggatcaggag
gatgtctatgcccatatcttcaatgggcgccgctatgacatcggtaataagttaggcttt
ctagaggcagtagttgagtttgcctttgcgcgggatgatatcagagctcctttcaaagat
tacttactggagtatctacctgaggaattgaaagaagaagtctttaatcgagcagcagct
aaatag

DBGET integrated database retrieval system