KEGG   Candidatus Amoebophilus asiaticus: Aasi_0029Help
Entry
Aasi_0029         CDS       T00730                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
aas00010  Glycolysis / Gluconeogenesis
aas00020  Citrate cycle (TCA cycle)
aas00620  Pyruvate metabolism
aas01100  Metabolic pathways
aas01110  Biosynthesis of secondary metabolites
aas01120  Microbial metabolism in diverse environments
aas01130  Biosynthesis of antibiotics
aas01200  Carbon metabolism
Module
aas_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aasi_0029
   00020 Citrate cycle (TCA cycle)
    Aasi_0029
   00620 Pyruvate metabolism
    Aasi_0029
Enzymes [BR:aas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Aasi_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 HlyD_3 AATase RnfC_N DUF2145
Motif
Other DBs
NCBI-ProteinID: ACE05486
JGI: Aasi0029
UniProt: B3EU67
Position
40678..41922
Genome map
AA seq 414 aa AA seqDB search
MAEVIRMPKMSDTMVEGVIAAWLKKVGDTVKSGDILAEVETDKATMELEAYESGTILYVG
VQEKQTVPINGVLAIIGKPNEDISALLTEIQQNTAPQAASENVTTTVSASPTTLLQPELP
QPNLNANNTGRTLISPLAKKMAQAQGHDITTIQGTGENGRIIKRDIESLVNRQIANSSWS
IDGSSNLQEAWETIPVSQIRKTIARRLIESKSAAPHFYLSISVNMDTLVAARVNLNQYTS
VKITFNDIIIKAVAVAIKQHLQVNTAWLGDTIRYNKHIHIGVAMAVEAGLLVPVVKFADH
KSLSQIATEVKTLTQRAHNNQLQPSDWEGSTFTISNLGMLGIESFTAIVNPPASCILAVG
AIQQVPIVKEGTIVPGHVMKVTLSCDHRVVDGAVGAAFLKTLKELLEEPLRLLV
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaattaggatgcctaaaatgagcgataccatggtagaaggtgtgatcgct
gcttggctaaaaaaagtaggcgataccgtaaaatctggagatattttagcagaagtggaa
acagataaagctacaatggagttagaagcttatgaatcaggcaccatattatatgttggt
gtccaagaaaagcaaacagttcctattaatggcgtacttgctattattggtaaacccaat
gaagatatttctgcattattaacagaaatacagcaaaacactgctcctcaagcagctagt
gaaaacgttaccactacggtctctgcctctcctaccacactattacaacctgagcttcca
cagcctaatttaaatgctaacaatactggacgcacactaatctctcctttagctaaaaag
atggcacaagcacaaggccatgatataaccaccatacaagggacaggagaaaacggtaga
attatcaaacgagacatagaaagcttagtgaacagacaaatagcaaacagcagttggtct
atagatggctcttctaacttacaagaagcttgggaaacaatacctgtttctcagatacgt
aaaactattgctagacggcttatagaaagtaaatcagcagccccacacttctatttaagc
atatccgttaacatggatacgttggtagctgcacgtgttaatttaaatcaatatacatct
gttaaaataacctttaatgatatcattattaaagcagtagcagttgctatcaaacagcat
ctccaggttaatacagcttggctaggagatactattagatacaataaacacatacatatt
ggcgtagccatggctgtagaagcaggcttattggtacctgttgttaagtttgcagatcat
aaatcattatcgcaaatagcaacagaagttaaaacactaacgcaaagagctcataataat
cagctacaaccttcggattgggaaggaagcacatttaccatatctaatttaggtatgcta
ggtatagaatcttttactgctattgttaacccaccagcatcttgtatacttgcagtaggt
gcaatacagcaagtacccattgtaaaagaaggaaccatagtccctgggcatgttatgaaa
gtaactttaagctgtgaccaccgagtggtagatggtgctgtaggcgctgcattccttaaa
actttaaaagaattactagaagaaccacttaggttactagtttag

DBGET integrated database retrieval system