KEGG   Candidatus Amoebophilus asiaticus: Aasi_0291Help
Entry
Aasi_0291         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K01921  
D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:aas00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(335351..336778)
Genome map
AA seq 475 aa AA seqDB search
MENKIRVGIFLGGSSREREISFAGGRTVYDNLDKGLFEPIPIFVDSFNNFIQLDWRYLYQ
GSIRDFYPPSDMLSLTKFQIYMESLGNLSPDQLSQYMARVGKKVTAEQLKGMIDFAFLSL
HGPCGEDGSIQGLLEWYKIPYSGSGILGTAVGIDKIVQKKWMQQAGFLVTPYSIIDRNTW
QKTTNKDALFEELIHTLGLPLVIKSPRQGSSIGVNIVYEKDFEAFTKAIHASFFIEQVTA
KQWQELSPQAKEQWLIKLVDLRSGIGLPVEINGHIIYHPEALLNFVDNYFNSCESPLDLV
SLQGEESVLVESFITGREFSCIVLQEAGNEPVALPPTEMLKGDLHFDYRAKYLPGLVRKQ
TPMTLPLAQLNTIKEACVQLFESLNFQVYARIDGIFSSDNSIYLNDPNTTAGMNPSSFLF
HQAAEIGLNPSQLLTFLIRNSLAARIYNHTINLKATKLLWLVDNYVACKISGNKQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaatcagagtagggatttttttagggggtagttctagagaacgtgagatt
tcttttgcaggcggacgaactgtatacgataatttagataaaggcttatttgaacctata
cctatttttgtagatagttttaacaattttatacagttagattggcgttatctatatcaa
ggcagcatacgcgatttttacccacctagtgatatgctatctcttactaaattccaaatc
tacatggaatcattgggtaacttatcacccgaccaactaagccaatatatggctagggta
ggcaaaaaggttacagcagaacaattaaaagggatgattgattttgcttttttatctttg
catggcccttgtggtgaagatgggagcatacagggtttattagaatggtataaaattcct
tattctggctcaggtatattaggaactgctgtaggtattgataagattgtacagaaaaag
tggatgcaacaagctggctttttagtaacaccatatagcattatagatagaaatacttgg
cagaaaacaacaaataaagatgctctttttgaagagctcatccatacattgggcctacca
ttggttataaaaagtccacgtcaaggttcttctattggtgtaaacattgtatatgaaaaa
gatttcgaagcctttaccaaggcaatacatgctagtttttttatagaacaagttactgct
aaacaatggcaagaactttctccgcaagcaaaagagcaatggcttattaagttggttgat
ttacgctcagggattgggctacctgtggaaataaatggccacattatttatcatcctgaa
gctttactaaactttgttgataattacttcaattcttgcgagtcgcctttagatttagtc
agcttacaaggagaagagtctgtacttgttgagtcatttattactggtagagaattttct
tgtattgtactgcaagaagcaggaaatgagccagtagccttgccgccaacagaaatgtta
aaaggcgatctacattttgattatagagccaagtatttaccaggattagtacgtaaacag
actcctatgacattgcctttagcacaactaaatactattaaagaagcttgtgtacaactc
tttgagagcttaaactttcaagtatatgccagaatagatggtatattttcgtctgacaat
agtatttacttgaatgatcctaacacaaccgctggcatgaatccttcttcatttttattt
caccaggctgctgaaatagggcttaatcctagccagttattaacttttttaataagaaat
tcgcttgctgcacgtatatacaatcatacaatcaatttgaaagctacaaaattattgtgg
cttgtagataactatgttgcatgcaaaataagtggcaataagcaataa

DBGET integrated database retrieval system