KEGG   Candidatus Amoebophilus asiaticus: Aasi_0300Help
Entry
Aasi_0300         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aas00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aas00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
346399..346893
Genome map
AA seq 164 aa AA seqDB search
MIKSIIVAKAVNHVIGNKGRLPWHMPADLKHFKELTGGHHVIMGRKTFESLPGSLPDRKI
IILSQSLNYKVEDCTVVPSLEMALEIANQANETEVFIAGGAAVYREALGIVDKIYLTVIH
TDVEGDTFFPTLKDHQWTEVSIVSHNHDIKHAYAYDFIELAKRI
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatccattattgtagctaaggcagttaaccacgtaattggaaacaagggtaga
ttaccttggcatatgcctgcagatttgaagcactttaaagagcttactggtgggcatcat
gttattatgggtaggaagacttttgaatccttaccaggatctttgccagaccgtaaaatt
attatattaagtcaaagcttaaactacaaggtagaagattgtacagtagtacctagctta
gaaatggctttagaaatagcaaatcaagccaacgagacagaagtatttatagcgggagga
gcagctgtttatagagaagcattaggtatagtagataaaatttacttgacagttattcat
acagatgtagagggtgatactttttttccaacattgaaagatcatcaatggacagaagtt
agtatagtttctcataaccatgatatcaaacatgcttatgcgtatgattttatagagctg
gcaaagcgtatttga

DBGET integrated database retrieval system