KEGG   Candidatus Amoebophilus asiaticus: Aasi_0300Help
Entry
Aasi_0300         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Aasi_0300
   00670 One carbon pool by folate
    Aasi_0300
Enzymes [BR:aas01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Aasi_0300
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
346399..346893
Genome map
AA seq 164 aa AA seqDB search
MIKSIIVAKAVNHVIGNKGRLPWHMPADLKHFKELTGGHHVIMGRKTFESLPGSLPDRKI
IILSQSLNYKVEDCTVVPSLEMALEIANQANETEVFIAGGAAVYREALGIVDKIYLTVIH
TDVEGDTFFPTLKDHQWTEVSIVSHNHDIKHAYAYDFIELAKRI
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgattaaatccattattgtagctaaggcagttaaccacgtaattggaaacaagggtaga
ttaccttggcatatgcctgcagatttgaagcactttaaagagcttactggtgggcatcat
gttattatgggtaggaagacttttgaatccttaccaggatctttgccagaccgtaaaatt
attatattaagtcaaagcttaaactacaaggtagaagattgtacagtagtacctagctta
gaaatggctttagaaatagcaaatcaagccaacgagacagaagtatttatagcgggagga
gcagctgtttatagagaagcattaggtatagtagataaaatttacttgacagttattcat
acagatgtagagggtgatactttttttccaacattgaaagatcatcaatggacagaagtt
agtatagtttctcataaccatgatatcaaacatgcttatgcgtatgattttatagagctg
gcaaagcgtatttga

DBGET integrated database retrieval system