KEGG   Candidatus Amoebophilus asiaticus: Aasi_0590Help
Entry
Aasi_0590         CDS       T00730                                 

Definition
(GenBank) hypothetical protein
Organism
aas  Candidatus Amoebophilus asiaticus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
759643..760701
Genome map
AA seq 352 aa AA seqDB search
MQLNLPLFKKVSETPGAPGFEQRIRQLIIEEIRTFVDHVEVDHMGNLIAVKYGVQQPSHE
KKVMVAAHMDELGLIVKYIDQEGFIRFHTLGGFDPRSLIGQRVIIHGKQDLVGVIGIKAI
HFMTEEERKRPLEISDLYIDIGRTQQQAATYISIGDSITRERSLIELGNCITGKSLDNRT
GVFVLIEALRTLQEVPYDVYAVFTVQEEVGLRGAQVAAHHIEPYFSLALDTSTSLDVPNV
QPHDRVARLGDGAGIKIMDGHTICDCRMVDYLKTIATQHNIAWQTDIKAVGGTDTAPLQR
MPKKGSIAGALSIPIRYAHQVVEVVHQADAISAIQLLQQALVGLDTYSWEQV
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttaatctaccattatttaaaaaagtcagtgaaacacccggtgctcccggattt
gagcagcgtattcgccaactaattatagaggaaataagaacttttgtagaccatgtagag
gttgaccatatgggtaatcttattgctgtaaaatatggtgttcagcaaccaagccatgaa
aagaaagtaatggtagcagcacatatggatgagttggggctgatagttaaatacatagac
caagaaggttttattaggtttcatacattaggtggatttgatcctagaagtcttattggt
cagcgggtgatcatacatggtaagcaagatttggtaggcgtcatcggcataaaagccata
cattttatgacagaagaagaaaggaaacgcccactcgaaattagtgatttatacattgac
ataggtagaacgcaacaacaggctgcgacctatatatctataggtgattctattacacgc
gaaagaagcttgatagagttaggtaattgtattactggcaagtcgctagataatcgaaca
ggtgtatttgtgcttatagaagcactacgtaccctacaagaagtaccttatgatgtttat
gctgtttttacagtgcaagaggaagtgggcctacgaggtgcacaagtggctgcacatcat
attgagccttattttagcttggcattagataccagtacttcattagatgtgcctaatgtg
caaccccatgatagggtcgctagattaggtgatggggcaggaattaaaattatggatggc
cataccatatgtgactgtcgaatggtagactatctgaagacaatagcaactcaacataat
attgcttggcaaacagatattaaagcagtaggaggaactgatactgctcccttgcaacgt
atgcctaaaaaaggatctattgcaggagccttaagtattcctatacgctatgctcaccaa
gtggtagaagtagtacatcaagccgatgcaatatctgctatacagcttttacaacaagct
ttagttggcttagatacttatagttgggagcaagtttag

DBGET integrated database retrieval system