KEGG   Candidatus Amoebophilus asiaticus: Aasi_0625Help
Entry
Aasi_0625         CDS       T00730                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aas00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aasi_0625 (recR)
DNA repair and recombination proteins [BR:aas03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Aasi_0625 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806000..806602
Genome map
AA seq 200 aa AA seqDB search
MAYTSKLIEEAINEISALPGIGKKTALRLVLFLLKSNPEQTERLATSLHKLRSQIQYCQK
CHNISDTTLCSICANPHRDTGLICVVENIQDVIAIENTAQYKGIYHVLGGLISPVEGIGP
EQLYIEHLVQRVQQEQPQEIIFALSTTIEGDTTTFYITKKLKEFPVKLSNIARGVAVGSE
LEYTDEMTLARSIKERILYH
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggcctatacctctaagctaatagaagaagctatcaatgaaatctccgctttgcctggt
ataggtaaaaaaacagcactgcgtctggtgttgtttttactaaagagcaatcctgagcaa
acagagcgtttagctacctcactgcataagctgcgttcacaaatacaatactgccaaaag
tgccataatatatcagatactaccctttgcagtatttgtgccaatcctcatagagataca
gggttgatatgtgtagttgaaaatatacaagacgtaatagctatagaaaatacagctcag
tacaaagggatctatcatgtattaggtggtttgatatcaccagtagaaggtatcggcccc
gagcaattatatatagaacatttagtccaaagagtccagcaggaacagcctcaagagata
atttttgcattaagtaccacaatagaaggagatactactaccttttatattacaaaaaag
ttaaaggagtttcctgttaagttgagtaatattgcacgtggtgtggcagtaggtagcgaa
ttagagtatacggatgaaatgactcttgctagaagtattaaagaacgtatattatatcat
taa

DBGET integrated database retrieval system