KEGG   Candidatus Amoebophilus asiaticus: Aasi_0642Help
Entry
Aasi_0642         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aasi_0642
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aasi_0642
  Amino acid metabolism
   00310 Lysine degradation
    Aasi_0642
Enzymes [BR:aas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Aasi_0642
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
826684..828036
Genome map
AA seq 450 aa AA seqDB search
MVVQKLSLHKNISMKELAIAMPKMGESVMEATIIKWLKKEGDEIAEAESILEVATDKVDS
EIPAPYTGKLKKILVQVGQVVAVGAPIAIFEVEDTTLLGNGQSISQSKIASQALPATKSF
ASSDSRPVKHTVQLHERTACPLYDTAGRFYSPLVRYIAQKESLSLEEMENIPGTGKDNRV
TKQDLLTYLAHRRSTQRSSSYSNLTIESIQQYAKPGDEIIPMDRVRKIIAERMVAAMHTV
PHVTSFVEADVTELVAWREKNKLAFKQKTGIGLTYTPLFVKAVAQAIQKFPLINVSVVGE
YIIKRKAINIGLAVALPDGNLIVPVVKNADQLTLSELAICIHKLVHNARHGQLLPDDIAD
GTYTISNIGSFQNLMGTPIIMQPQVAILAVGSIVKKPAVIETAQGEQITIRHQMYLSHTY
DHRVVDGALGGQFAKAVADYLEKFDFAKES
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atggtagtacaaaaattaagtctacataagaatataagtatgaaagaattagcaatagct
atgcccaaaatgggtgaaagtgtaatggaagccactattatcaagtggcttaaaaaggaa
ggagatgaaattgcagaagctgaatctatactagaagtagctacagataaagtggattcg
gaaatacctgccccttatacagggaagctaaagaagattttggtacaagtaggccaggta
gtagctgtaggagctcccatagcaatttttgaagtagaagacacaaccttattaggcaat
ggacaatctatatctcaatctaagatagcttcgcaggctcttcctgctactaagtctttt
gcttcttctgattctcgacctgtcaaacatactgtgcaattacatgagcgtactgcctgc
cctctctatgatacagctggtagattttactcacccttagttcgatatatagctcaaaaa
gagtctctttcattagaggagatggagaacattcctggtacagggaaagataatcgcgta
accaagcaagatcttcttacatatttagcacatagaaggagtacccaacgcagctctagt
tatagcaatcttaccatagaaagtatacaacaatatgctaagccaggggatgagattata
ccaatggatagggtaagaaaaattattgcggagcgaatggtagcagccatgcatacagtt
ccacatgtaacctcttttgtagaggctgatgtaactgaattagtagcatggagagagaaa
aataaattggcatttaagcaaaaaacaggtataggacttacttatacacctctttttgta
aaagctgttgcacaggccatacaaaaattccctctaattaatgtgtcggtagtaggagaa
tacattattaaacgtaaagctatcaatataggcttggctgttgctctgccagatggaaat
ctaattgtgccagttgttaaaaatgcagatcaacttactttgtctgagttggctatatgt
attcataagttagtgcataatgctcggcatggacagcttttgccagatgatattgcagat
ggtacttatactatttctaacataggctcttttcaaaatttgatgggaacacccattatt
atgcagccgcaggtagctattttagcagtaggtagtattgtaaaaaagcctgctgttatt
gaaacagcacaaggtgaacaaattaccattcgtcatcaaatgtacctatcccatacatat
gatcatcgtgtagtagatggtgctttaggtggacagtttgctaaggctgtggctgattat
cttgaaaaatttgattttgctaaagaaagttga

DBGET integrated database retrieval system