KEGG   Candidatus Amoebophilus asiaticus: Aasi_0858Help
Entry
Aasi_0858         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:aas00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1089606..1090580
Genome map
AA seq 324 aa AA seqDB search
MLHSRIHPLKFITKPAAQIYIKRDDELGFGVTGTKLRKYQSLLHYIKTQAIKHAVLIGGA
YSNNIVSLSQLLIEQGVVPHLFLRGDKPPAHKGNFLLTSLLVPTKHIYWIKRDEWEDVEN
RAKAFAEKLPEASLVIPEGACMVESLPGALSLGTDILRNEQEHDLLFDHIFIEAGTGLAA
IGLILGFKIYRKTVQIHILLLAGHEAEFLKKLESFHQYLFFNYQVKIEWDELIQGLHFYH
PNTAVSFGTTNKQVFDAIIQIARHDGILTDPIYSAKLLMMAKHTILTSDIVGNILIIHSG
GGLALMGFQEQLASQLQCIIEKSS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcttcattctcgcattcatcctctcaagtttataacaaaacctgcagctcaaatatat
atcaagagagatgatgaacttggctttggcgttactggtaccaaactgagaaaatatcaa
tcacttctacattatattaaaacacaagctatcaagcatgctgtacttatcggtggggct
tactccaataatattgttagcttatctcagcttcttatcgaacaaggtgtagtacctcat
ttattcttaagaggagataagccacctgcccataaaggaaactttttactaacttctttg
ctagtacctactaagcatatctattggataaaaagagatgaatgggaggatgttgaaaac
cgggcaaaggcttttgcagaaaaacttccagaagcatctttagtaattcccgaaggtgct
tgcatggttgagtctttaccaggagcacttagccttggcactgatattttaaggaacgag
caagagcatgaccttttattcgatcatatttttatagaagcaggaacaggtctagcagct
attggcttaatcttaggttttaaaatataccgaaaaactgtacagatccatattttgctt
ttagcaggccatgaggctgaatttttaaaaaagttggagagttttcatcagtacttattt
ttcaactatcaagtaaaaatagaatgggatgagcttatacaagggcttcatttttaccat
cccaatacagctgtgtcgtttggcactactaataaacaagtttttgatgctattattcaa
attgctagacatgatggtatcctaacagatcctatctattctgctaaactattgatgatg
gccaaacatactattcttacatcagatatagtagggaatatacttattattcacagtggt
ggcggactagcattaatgggatttcaagaacaattagcaagtcaattacaatgcataata
gagaagagctcttag

DBGET integrated database retrieval system