KEGG   Candidatus Amoebophilus asiaticus: Aasi_0858Help
Entry
Aasi_0858         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:aas00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Aasi_0858
Enzymes [BR:aas01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     Aasi_0858
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1089606..1090580
Genome map
AA seq 324 aa AA seqDB search
MLHSRIHPLKFITKPAAQIYIKRDDELGFGVTGTKLRKYQSLLHYIKTQAIKHAVLIGGA
YSNNIVSLSQLLIEQGVVPHLFLRGDKPPAHKGNFLLTSLLVPTKHIYWIKRDEWEDVEN
RAKAFAEKLPEASLVIPEGACMVESLPGALSLGTDILRNEQEHDLLFDHIFIEAGTGLAA
IGLILGFKIYRKTVQIHILLLAGHEAEFLKKLESFHQYLFFNYQVKIEWDELIQGLHFYH
PNTAVSFGTTNKQVFDAIIQIARHDGILTDPIYSAKLLMMAKHTILTSDIVGNILIIHSG
GGLALMGFQEQLASQLQCIIEKSS
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcttcattctcgcattcatcctctcaagtttataacaaaacctgcagctcaaatatat
atcaagagagatgatgaacttggctttggcgttactggtaccaaactgagaaaatatcaa
tcacttctacattatattaaaacacaagctatcaagcatgctgtacttatcggtggggct
tactccaataatattgttagcttatctcagcttcttatcgaacaaggtgtagtacctcat
ttattcttaagaggagataagccacctgcccataaaggaaactttttactaacttctttg
ctagtacctactaagcatatctattggataaaaagagatgaatgggaggatgttgaaaac
cgggcaaaggcttttgcagaaaaacttccagaagcatctttagtaattcccgaaggtgct
tgcatggttgagtctttaccaggagcacttagccttggcactgatattttaaggaacgag
caagagcatgaccttttattcgatcatatttttatagaagcaggaacaggtctagcagct
attggcttaatcttaggttttaaaatataccgaaaaactgtacagatccatattttgctt
ttagcaggccatgaggctgaatttttaaaaaagttggagagttttcatcagtacttattt
ttcaactatcaagtaaaaatagaatgggatgagcttatacaagggcttcatttttaccat
cccaatacagctgtgtcgtttggcactactaataaacaagtttttgatgctattattcaa
attgctagacatgatggtatcctaacagatcctatctattctgctaaactattgatgatg
gccaaacatactattcttacatcagatatagtagggaatatacttattattcacagtggt
ggcggactagcattaatgggatttcaagaacaattagcaagtcaattacaatgcataata
gagaagagctcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system