KEGG   Candidatus Amoebophilus asiaticus: Aasi_1062Help
Entry
Aasi_1062         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aas00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Aasi_1062
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Aasi_1062
Enzymes [BR:aas01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Aasi_1062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1375083..1375643
Genome map
AA seq 186 aa AA seqDB search
MQITKTPTLGLTIIGPELKTDQRGYFMECYHQEKLTQLGIHNQFVQENQSFSKKGTIRGL
HYQLNPYAQAKLIRVIDGAIWDIIVDLRQGSTTFGQWEGIMLSAENNKQLLIPRGYAHGF
AVMSQEATIIYKCDNFYHPEAEAGIHWLDPELAIDWKINAPPLLSARDQQLPCLEKAIIN
FDYQSL
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgcagataacaaaaacgccaactttaggcttaacaattattgggccagaattaaaaact
gaccagcgtggttattttatggaatgttatcatcaagaaaaattaactcagctaggtata
cacaaccaatttgtacaagaaaaccagtccttttctaaaaaaggaaccattagaggttta
cattatcagcttaatccgtatgcgcaagcaaagcttattcgtgtaatagacggagcaata
tgggatataatcgtagacctccgacaaggaagtactacctttggccagtgggagggcatt
atgctttcggctgaaaataataaacagctactgataccgcgtggttatgcccatggattt
gcggtcatgagccaggaagcgaccattatttataaatgtgacaatttttaccatccagaa
gcagaagcgggcattcactggctagatcctgagttagcaatagactggaaaataaatgcc
cctcctctactctctgccagagatcaacaattaccatgtttagaaaaagcgattattaac
tttgattatcaatcgttatga

DBGET integrated database retrieval system