KEGG   Candidatus Amoebophilus asiaticus: Aasi_1135Help
Entry
Aasi_1135         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
aas  Candidatus Amoebophilus asiaticus
Brite
Enzymes [BR:aas01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Aasi_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1449586..1450200)
Genome map
AA seq 204 aa AA seqDB search
MKSNNHLVKYLVNKGILRSKEIINAFTVIDRKDFVGLENLDNAYEDYALSIGYDATISQP
TTVAFMLEKLGIMPGDIVLDVGTGSGWTTALLATIVGGKGRVYGVEIVPELVALGQYNLS
KYKFSNASIEQSGEILGLPDNAPFDRILVSAGTDDLPKELLMQLKEGGNLIIPIDASIWK
VEKRHNSATTIYKYPGFIFVPLQK
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtaataatcacttagttaagtatttggtaaacaagggtatccttaggtcaaag
gaaatcattaatgcctttacagtaatagaccgaaaagactttgttggcttagaaaatcta
gataatgcttatgaggactatgcacttagtattggctatgatgcaactatttctcagcct
actacggtagcctttatgctagaaaaactaggcataatgcctggtgatatagtattagat
gttggaacaggctctggttggaccacagcacttttagctactatagtagggggaaagggg
cgagtatatggggttgaaattgttcctgagttagtagctttagggcaatataatcttagt
aaatataagttttcgaatgccagtatagagcaatctggggaaatattagggctaccagat
aatgcaccatttgatcggatattggtttctgctggtactgatgatctgcctaaagaattg
ctaatgcaattaaaagaggggggtaatttaattataccaatagatgcatcaatttggaaa
gtagaaaaaagacataattcagcaactactatttataaatatccaggttttatatttgtg
ccattacagaaatag

DBGET integrated database retrieval system