KEGG   Candidatus Amoebophilus asiaticus: Aasi_1151Help
Entry
Aasi_1151         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aas00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Aasi_1151
Enzymes [BR:aas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Aasi_1151
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1470391..1471434
Genome map
AA seq 347 aa AA seqDB search
MKLFSHTNHMPTTRASLFHTNVSIEEASLIVIPAPWEVTVSTRSGTALGPETILKASYQL
GLYSPRFPNIDQISIAMLPIPHDWKILSDTLRHDTAGYIHALELGIQYTTMPKSILQKIN
SHTRLFLDELKNKALNYLNKGKIVSVVGGEHIVALGLVEALTEKYSNFGMLHLNAHATLH
KAYQGFTYSHASLMHNVLKLPQVETVVQIGLRDYTKEEAQVIDSSKGRIITFLNDTLKAE
KFQGITWDTSCKKIIDALPEHIYISFDIDSLDASLCPSTGTPVPGGLGFDEVCYLFKCLV
NAGKKVIGFDLCEVSPGEQFDLDAQVGSRMLYQLALTTAASQNTLNS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcttttctcataccaatcatatgccaactactagagctagcctttttcatacc
aatgtttctattgaagaagcatctttgatagtaattcctgcgccttgggaggtgactgta
tctacaagatcaggtacagcattagggcctgaaaccattttaaaagcttcttatcaacta
ggcctttattctcctagatttcctaatatagatcaaatatctatagctatgttaccgatc
ccccatgactggaaaatattaagtgatacgctcaggcatgatacggctggatatattcat
gcattagagttaggaattcaatatactacgatgcctaaaagtatcttacaaaaaattaat
tcacacacacgactttttttagatgagttaaaaaataaagccttaaactatttaaacaaa
ggcaaaatcgtgtcagtagtaggcggtgaacacattgtagcattagggcttgtagaagca
ttgacagaaaaatattcaaattttggtatgctccacctcaatgctcatgctacgttacat
aaggcgtaccaaggatttacttattctcatgcttcattaatgcataatgtattaaaatta
ccccaagttgaaacagtagtacaaataggcttgcgtgactatacaaaagaggaagcacaa
gtaattgatagttcaaaaggacgtattataacctttttaaatgacacgctaaaagcagaa
aagtttcaaggaattacctgggatacaagctgtaaaaaaataatagatgcactaccagaa
catatctatatcagtttcgatatagatagtttagatgcaagtttatgtcctagcacaggg
actcccgtgccaggcggtctaggatttgatgaagtatgctatttgtttaaatgtttagta
aatgctgggaagaaagttattggttttgatttatgtgaagtttctcctggagaacagttt
gacttagatgcacaggtaggtagtagaatgctataccaacttgctttaacaacagctgct
agccaaaatacattaaatagttaa

DBGET integrated database retrieval system