KEGG   Candidatus Amoebophilus asiaticus: Aasi_1507Help
Entry
Aasi_1507         CDS       T00730                                 

Definition
(GenBank) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
aas00010  Glycolysis / Gluconeogenesis
aas00051  Fructose and mannose metabolism
aas00562  Inositol phosphate metabolism
aas01100  Metabolic pathways
aas01110  Biosynthesis of secondary metabolites
aas01120  Microbial metabolism in diverse environments
aas01130  Biosynthesis of antibiotics
aas01200  Carbon metabolism
aas01230  Biosynthesis of amino acids
Module
aas_M00002  Glycolysis, core module involving three-carbon compounds
aas_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:aas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aasi_1507
   00051 Fructose and mannose metabolism
    Aasi_1507
   00562 Inositol phosphate metabolism
    Aasi_1507
Enzymes [BR:aas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aasi_1507
Exosome [BR:aas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aasi_1507
  Exosomal proteins of bladder cancer cells
   Aasi_1507
  Exosomal proteins of melanoma cells
   Aasi_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACP20869
UniProt: B3ER35
Position
complement(275108..275911)
Genome map
AA seq 267 aa AA seqDB search
MEKCGNRFRIKAKNMQRTIIAANWKMNKNFQEGLQLAKEITQFIQAEPLAGAQIILFPSF
IHLEGISKLLTPEVKLHLGAQNCHDQIAGAFTGEVSAAMLASIDVRYVLVGHSERRQNFA
EDNDLIAKKIDAILSCKLQPVFCCGEPLSVRESNQHYAFIEQQIAESLFHLTPDELQQVI
IAYEPIWAIGTGLIPSLAEIEEMQQTIRNILKKQYNTVLADNMAILYGGSCNASNITKLI
SLPGINGVLIGGASLHFKEFIHILRSL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttggagaagtgtggcaatagatttagaataaaagcaaagaatatgcaacgtactataatt
gctgctaactggaaaatgaataaaaattttcaggaaggattacagttagctaaagaaata
acacaatttatacaggctgagcccctagctggtgcacagattatactgtttccttcgttt
atacatttagaggggatcagtaagctattgacaccagaggtcaaattgcatttaggagca
caaaattgtcatgaccagattgctggggcttttacaggtgaagtatccgcagctatgctt
gcttctatagatgttcgatatgtgttggtagggcatagcgagcgaaggcaaaattttgca
gaggataatgatttgatagctaagaaaattgatgccatattgagttgtaagctacagcct
gtcttctgttgtggtgaacctttatcagtaagggaaagtaaccagcattatgcttttatt
gagcaacagattgccgaaagcctatttcatcttacgcctgatgagttacaacaagtaatt
attgcttatgagcctatctgggctattggaactggattgatccccagcttagcggaaata
gaagagatgcagcagacaatcaggaatattttaaagaaacaatacaatactgtcttagca
gataatatggctattttatatggaggaagctgtaatgcgtcgaatataacaaaacttatt
agcttgcctggaataaatggtgtgcttatagggggggcatccttgcattttaaagaattt
atacatatattaaggtctctataa

DBGET integrated database retrieval system