KEGG   Candidatus Amoebophilus asiaticus: Aasi_1507Help
Entry
Aasi_1507         CDS       T00730                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
aas  Candidatus Amoebophilus asiaticus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:aas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aasi_1507
   01230 Biosynthesis of amino acids
    Aasi_1507
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aasi_1507
   00051 Fructose and mannose metabolism
    Aasi_1507
   00562 Inositol phosphate metabolism
    Aasi_1507
Enzymes [BR:aas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aasi_1507
Exosome [BR:aas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aasi_1507
  Exosomal proteins of bladder cancer cells
   Aasi_1507
  Exosomal proteins of melanoma cells
   Aasi_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(275108..275911)
Genome map
AA seq 267 aa AA seqDB search
MEKCGNRFRIKAKNMQRTIIAANWKMNKNFQEGLQLAKEITQFIQAEPLAGAQIILFPSF
IHLEGISKLLTPEVKLHLGAQNCHDQIAGAFTGEVSAAMLASIDVRYVLVGHSERRQNFA
EDNDLIAKKIDAILSCKLQPVFCCGEPLSVRESNQHYAFIEQQIAESLFHLTPDELQQVI
IAYEPIWAIGTGLIPSLAEIEEMQQTIRNILKKQYNTVLADNMAILYGGSCNASNITKLI
SLPGINGVLIGGASLHFKEFIHILRSL
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
ttggagaagtgtggcaatagatttagaataaaagcaaagaatatgcaacgtactataatt
gctgctaactggaaaatgaataaaaattttcaggaaggattacagttagctaaagaaata
acacaatttatacaggctgagcccctagctggtgcacagattatactgtttccttcgttt
atacatttagaggggatcagtaagctattgacaccagaggtcaaattgcatttaggagca
caaaattgtcatgaccagattgctggggcttttacaggtgaagtatccgcagctatgctt
gcttctatagatgttcgatatgtgttggtagggcatagcgagcgaaggcaaaattttgca
gaggataatgatttgatagctaagaaaattgatgccatattgagttgtaagctacagcct
gtcttctgttgtggtgaacctttatcagtaagggaaagtaaccagcattatgcttttatt
gagcaacagattgccgaaagcctatttcatcttacgcctgatgagttacaacaagtaatt
attgcttatgagcctatctgggctattggaactggattgatccccagcttagcggaaata
gaagagatgcagcagacaatcaggaatattttaaagaaacaatacaatactgtcttagca
gataatatggctattttatatggaggaagctgtaatgcgtcgaatataacaaaacttatt
agcttgcctggaataaatggtgtgcttatagggggggcatccttgcattttaaagaattt
atacatatattaaggtctctataa

DBGET integrated database retrieval system