KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0014Help
Entry
D11S_0014         CDS       T00993                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aat01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:aat00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(9507..10007)
Genome map
AA seq 166 aa AA seqDB search
MMEIVRQLAQLHQAGFRLVIVTSGAIAVGRHYLNHPQLPPTVASKQLLAAVGQSQLIQTW
EKLFAIYDIHIGQMLLTRTDIEDRERFLNARDTLHALLDNRIIPVINENDAVATAEIKVG
DNDNLSALVAILVQADRLESRKQWLFAAPSAGVLTIDEMKAHKVRC
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgatggaaatcgttcgtcagttggcgcagttacatcaggcgggctttcgcctggtgatc
gtgacttcgggtgccattgccgtcggtcgccattatttaaatcacccgcaattgccaccc
accgtggcgtccaaacaattgctggcagcagtggggcagagccagctgattcaaacctgg
gaaaaactgtttgccatttatgatattcacatcgggcaaatgttgctgacccgcaccgat
attgaagatcgcgaacgtttcctgaatgcacgcgacaccttgcacgcgttgttggataac
cgcattattccggtgatcaacgaaaatgatgcggttgcaacggcagaaattaaagtgggg
gataacgataatttatcggcgctggtggcgattttggtgcaggcagatcgtttggaaagc
cgtaaacaatggctgttcgccgcgccgtcggcaggcgtgctgaccattgatgagatgaag
gcgcacaaagtgcggtgttaa

DBGET integrated database retrieval system