KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0018Help
Entry
D11S_0018         CDS       T00993                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:aat00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aat00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11534..12019
Genome map
AA seq 161 aa AA seqDB search
MRLSLIVAMTKNHVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN
IVLSRQPFVHDGIIWKDSLESAVDFVIDSDEIMLIGGGQLFKQYLPQATRLYLTEIQTEL
EGDTFFPPIDWNHWNIEFEQYRPADEQNPYDCRFMILVRKG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaagcctgattgtcgccatgaccaaaaaccatgtcatcggcaaagataaccaa
atgccatggcacctgcccgccgacctcgcctggtttcgccaaaataccaccggcaaaccc
gtcatcatgggacgcaaaacctttgaaagcatcggtcgcccattaccgaaacgtaccaac
atcgtgctttcccgccaacctttcgtgcacgacggcattatttggaaagacagcctggaa
agtgcggtggattttgtcatcgattccgacgaaatcatgctcatcggcggcggtcagctg
ttcaagcaatatttaccgcaggcgacccgcctttacctcaccgaaatccaaactgaactg
gaaggcgacaccttcttcccgcctattgattggaaccactggaacattgaatttgaacaa
taccgccccgccgacgaacaaaatccttacgattgtcgttttatgattttggtgcggaaa
gggtaa

DBGET integrated database retrieval system