KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0018Help
Entry
D11S_0018         CDS       T00993                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    D11S_0018
   00670 One carbon pool by folate
    D11S_0018
Enzymes [BR:aat01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     D11S_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11534..12019
Genome map
AA seq 161 aa AA seqDB search
MRLSLIVAMTKNHVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGRKTFESIGRPLPKRTN
IVLSRQPFVHDGIIWKDSLESAVDFVIDSDEIMLIGGGQLFKQYLPQATRLYLTEIQTEL
EGDTFFPPIDWNHWNIEFEQYRPADEQNPYDCRFMILVRKG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttaagcctgattgtcgccatgaccaaaaaccatgtcatcggcaaagataaccaa
atgccatggcacctgcccgccgacctcgcctggtttcgccaaaataccaccggcaaaccc
gtcatcatgggacgcaaaacctttgaaagcatcggtcgcccattaccgaaacgtaccaac
atcgtgctttcccgccaacctttcgtgcacgacggcattatttggaaagacagcctggaa
agtgcggtggattttgtcatcgattccgacgaaatcatgctcatcggcggcggtcagctg
ttcaagcaatatttaccgcaggcgacccgcctttacctcaccgaaatccaaactgaactg
gaaggcgacaccttcttcccgcctattgattggaaccactggaacattgaatttgaacaa
taccgccccgccgacgaacaaaatccttacgattgtcgttttatgattttggtgcggaaa
gggtaa

DBGET integrated database retrieval system