KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0244Help
Entry
D11S_0244         CDS       T00993                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:aat00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
220652..221935
Genome map
AA seq 427 aa AA seqDB search
MAYCVFSYAGAFILLPDNSAKCGQNFMQNKQKVVILGATGSIGNSALSVIEHNPENYEAF
ALVGGSNATAMFEKCLKFRPHFVALADEYAAKVLREKLTAHQIPTQVLAGQQAICELSAH
PDADMVMAAIVGAAGLLPTLSAVKAGKKVLLANKEALVTCGQIFIDAVKQHGAQLLPVDS
EHNAIFQSLPPQAQQQIGFCPLADLGISKIVLTGSGGPFRYTALSEFDGITPEQAVAHPN
WSMGKKISVDSATMMNKGLEYIEARWLFNVSADEMEVIIHPQSIIHSMVRYIDGSVIAQM
GNPDMRTPIAETMAYPHRTFSGVAPLDFYQLNGLTFLAPDYQRYPCLKLAIEAFAAGQYA
TTAMNAANEIAVQAFLDRQIKFTDIAKLNQAVVEQIAPQQIKQIDDVLDVDRAARECARK
QLAHWSH
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtggcttactgcgtcttttcttatgcgggcgcgtttattttattgcccgacaactctgca
aagtgcggtcaaaattttatgcaaaacaaacaaaaggtcgtgattctcggtgctacaggt
tctatcggcaacagcgccctgtcggtgattgaacacaatccggaaaactatgaggcgttt
gccttggtgggcggttccaatgcgacggcgatgtttgaaaaatgcctgaaatttcgaccg
cactttgttgctttagctgatgaatacgcagcgaaagtattgcgcgaaaaattaacggct
catcagattccaacccaagttttggcggggcagcaggcgatttgtgaattgagtgcgcat
cctgatgcagacatggtgatggcggcgattgtgggtgcggcgggcttgttaccgacccta
tctgcagttaaagcgggtaagaaagtgttactggcgaacaaagaggcgctggtgacttgc
ggtcaaatttttattgatgccgtgaaacagcatggcgcgcaattattgccggtggacagc
gaacataacgccatttttcaatcgttgccaccacaggcgcagcaacaaatcggtttttgc
ccgttggcggatttgggcatcagcaaaatcgtgctgaccggttccggcggacctttccgt
tatacggcgttaagcgaatttgacggcattacgccggaacaagcggtagcgcatccgaac
tggtctatgggcaagaaaatttccgtggattccgccaccatgatgaacaaaggcttggaa
tatattgaagcccgctggttgtttaacgtgtccgccgacgaaatggaagtgattattcac
ccgcaatccattattcattctatggtgcgttatatcgacggcagcgtcatcgcgcaaatg
ggcaatcctgatatgcgcacgccgatcgccgaaaccatggcgtatccgcaccgcacgttt
tccggcgtcgcgccgctagatttctatcaattaaacgggctgacttttttggcaccggac
tatcaacgttatccttgcttgaaactcgccatcgaggcgttcgccgccggtcaatatgct
acgacggcaatgaatgccgccaatgaaatcgctgtgcaggcatttttagatcgccaaatt
aaatttaccgacattgccaaacttaatcaggcggtggtggaacaaattgcaccgcaacaa
atcaaacaaattgatgatgtgttggacgtcgatcgcgcagcgcgtgagtgcgcgcgtaaa
caattggcacattggtctcactga

DBGET integrated database retrieval system