KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0346Help
Entry
D11S_0346         CDS       T00993                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:aat00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:aat00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319625..320944
Genome map
AA seq 439 aa AA seqDB search
MTNYLNNIDKVRYEGPDSTNPFAYKYYDANQVTLGKTMAEHLRLAVCYWHTFCWNGTDMF
GLGSLDRSWQKNAGTLEAAKQKADIAFEFFTKLGVPYYCFHDVDVAPEGNSIKDYIHNFN
TITDILERKQAETGVKLLWGTANCFSHPRYMSGASTNPNPEVFAWAATQVYHAMNATKRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQMVVEHKHNIGFNGTLLIEPKPQEPTK
HQYDYDVAMVYGFLKQFGLENEIKVNIEANHAILAGHTFQHEVATAFALDIFGSIDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKNGGFTTGGFNFDAKIRRQSTDPYDLFYAHIGAI
DVLALSFKRAAQILEEQRLQQIVDARYAGWRQSLGQQILQGNASLAQLAQAVEQQGLDPQ
PVSGKQEYLENLVNGYIYR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgacaaactatttaaacaatattgacaaagttcgctacgaaggtcctgactcaaccaat
cccttcgcgtataaatattacgacgccaatcaggtcactcttggcaaaaccatggcggag
catttgcgtttggcggtatgttattggcatacgttttgctggaacggtaccgatatgttc
ggcttgggttcgctggatcgcagctggcagaagaatgccggcacgttagaggcggcaaaa
caaaaagcggacattgcttttgagtttttcaccaaattaggcgtgccttattattgtttc
cacgatgtggatgtggcgccggaaggcaattccattaaggattacattcataatttcaac
acgataacggacattcttgaacgtaaacaggcggaaaccggcgtaaaattgctatggggt
acggcaaactgtttcagccatccgcgttatatgtccggcgcctccaccaatccgaatccg
gaggtgttcgcctgggcggcaacgcaggtatatcacgccatgaatgctaccaagcgtttg
ggcggcgaaaactatgtgctctggggcggtcgcgaaggttatgaaaccctgcttaatacg
gatttaaaacgtgaacgcgaacaaatcggacgcttcatgcaaatggtggtggaacataaa
cataacatcggctttaacggcacgttgctcattgaaccgaaaccgcaggaaccgactaaa
catcaatacgattatgatgtggcgatggtgtacggtttcttaaaacagttcggtttggaa
aatgaaattaaagtgaacattgaagccaaccacgccatcttggcggggcacaccttccag
catgaagtggcaacagcgttcgcgctggatattttcggttccatcgacgccaaccgtggc
gacccacaattaggctgggacaccgaccaattcccgaacagtgtggaagaaaatacgctg
gtgatgtatgaaattctgaaaaacggtggctttactaccggcggtttcaactttgatgcg
aaaatccgccgtcaaagtaccgatccttatgatttgttctatgcgcacatcggtgctatc
gacgtgttggcgttatccttcaaacgggcggcacaaatactggaagaacaacgcctgcaa
caaatcgtcgatgcgcgttatgccggttggcggcaatccctcggtcagcaaattttgcag
ggtaacgcttctttggcacagctcgcgcaggcggttgagcaacaaggcttggatccgcaa
ccggtgtccggtaaacaggagtatctggaaaacttggtgaacggttacatttaccgttaa

DBGET integrated database retrieval system