KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0360Help
Entry
D11S_0360         CDS       T00993                                 

Definition
CrcB protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    D11S_0360
Enzymes [BR:aat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     D11S_0360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331598..332521
Genome map
AA seq 307 aa AA seqDB search
MNNTELLQFAAQFPLQYLQGERQCRLAYRHFMHHPAARKLVIMVNGRAENLLKWTEIAQD
FYHQGYDVLLFDHRGQGYSQRLLKDGEKGHLDEFRFYPQDMAKIIENLTALYPYPQQYLI
AHSLGALISAYYLANFDHRIERAVFSAPFFGVPLKKPTRDELLLNLMMLWGQGERYVFGK
SAYKPVDTAQNELSHSVARMQWMNDVNRDNPSIRLGGPTFRWVHLCLAAIKRLPKILPRI
ETPVLVLEAEQEKIVNNKTLKKLTALLPHGERRKIHGAKHEILFESDEIRTPVLQRIYAF
FNPNKHA
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaccgaactgttgcaatttgccgcgcaatttccgttgcaatatcttcagggc
gaacgccaatgccgcttggcttatcggcattttatgcaccaccccgccgcccgtaaatta
gtgattatggtgaacggcagggcggaaaacctgctgaaatggacggaaattgcgcaggat
ttttatcatcaaggctacgatgtgttactgtttgatcatcgcgggcagggttattcgcaa
cgtttattgaaagatggcgagaaagggcatttagacgaatttcggttttacccgcaggac
atggcaaaaatcattgaaaatctgaccgcactttatccttatccgcagcaatacctgatc
gcccattccctcggcgcgctgatttccgcctattatttggcgaattttgatcatcgtatt
gaacgggcagtcttctccgcgccctttttcggggtgccactcaaaaagccgacgcgcgac
gaattattgctgaatttgatgatgttatggggacaaggtgaacgttatgtgttcggcaaa
agcgcctacaagccagtggatacggcacagaacgagttaagtcacagtgtggcgcggatg
caatggatgaatgacgtgaatcgggacaacccgtcaattcggctgggcggaccgaccttc
cgttgggtacatttgtgtctcgccgccattaagcgtctgccgaaaattctgcctcgtatc
gaaacgccggtgttagtgttggaggccgaacaggaaaagatcgtgaacaataaaacgctg
aaaaaactgaccgcacttttgccccacggagagcggcgaaaaattcacggcgccaaacac
gaaattctgtttgaaagcgatgaaattcgtaccccggtactacaacgcatttatgcgttt
tttaatccaaacaagcacgcataa

DBGET integrated database retrieval system