KEGG   Aggregatibacter actinomycetemcomitans D11S-1: D11S_0503Help
Entry
D11S_0503         CDS       T00993                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
aat  Aggregatibacter actinomycetemcomitans D11S-1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D11S_0503
Enzymes [BR:aat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     D11S_0503
Exosome [BR:aat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   D11S_0503
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(457706..458728)
Genome map
AA seq 340 aa AA seqDB search
MTQQIFTGFPTRRLRRMRKQDFSRRLMAEHKLTVDDLIYPVFIIEGENHREAVPSMPNVE
RLTLDQLLIEAGLLVKYGVPVIALFPVVEQTKKSLMAEEAYNPNGLVQRAVRALKAAYPE
LGVLTDVALDPYTVHGQDGIIDEDSYVLNDITTEVLIKQALSHAEAGADVVAPSDMMDGR
IGRIRHALEENGFINTLIMAYSAKYASNYYGPFRDAVGSSGNLKGGDKKTYQLDPANSDE
GLQEVALDLEEGADMVMVKPGMPYLDLVYRVKQQFGVPTFAYQVSGEYAMHMAAIQNGWL
KEKECIMESLLCFKRAGADGILTYFAKQVAEWLYLEGKNK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaacaaattttcaccggttttcccacccgccgtttacgccgcatgcgtaaacag
gactttagtcgccgcttgatggcggaacacaaactgaccgttgacgatctgatttatccc
gtgtttattattgaaggcgaaaatcaccgcgaagccgtgccttccatgccgaatgtagaa
cgtttaacccttgatcagttgttaattgaagcaggattattggtgaaatacggtgtgccg
gtcatcgccctgttccctgtggtggagcaaaccaaaaaatccctcatggcggaagaagcc
tataatccgaacggcttggtgcaacgcgcggtaagagccttaaaagccgcttatcccgaa
ctgggcgtattaaccgatgtggcacttgacccttacaccgtgcacgggcaagacggcatt
atcgacgaggacagctatgtactgaacgacatcaccaccgaagtgttaatcaaacaagcc
ctttcccacgcggaagccggcgccgatgtggtagcgccaagcgacatgatggacggtcga
atcggcagaatccgccacgcgctggaagaaaacggctttatcaataccctcatcatggca
tactccgccaaatatgcctccaactattacggcccgttccgcgacgcggtgggttcttcc
ggtaatttaaaaggtggcgataaaaaaacctatcaacttgatcccgccaatagcgacgaa
ggcttgcaggaagtggcgttagacttggaagaaggcgccgatatggtgatggtcaaaccg
ggcatgccgtatttggatttggtctatcgcgtgaaacaacaattcggcgtgccgaccttc
gcctaccaagtctccggcgaatacgccatgcacatggcagccattcaaaacggttggctg
aaagaaaaagagtgcatcatggaatcgctactttgcttcaaacgcgccggcgccgacggc
attctgacttacttcgccaaacaagtggcggaatggttgtacttggaagggaaaaataaa
tag

DBGET integrated database retrieval system